KEGG   Zootermopsis nevadensis: 110834497Help
Entry
110834497         CDS       T05136                                 

Definition
(RefSeq) uncharacterized protein LOC110834497 isoform X1
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
zne  Zootermopsis nevadensis
Pathway
zne04137  Mitophagy - animal
zne04141  Protein processing in endoplasmic reticulum
zne04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:zne00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110834497
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110834497
  09143 Cell growth and death
   04214 Apoptosis - fly
    110834497
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:zne03000]
    110834497
Transcription factors [BR:zne03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    110834497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 FAM199X bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 110834497
NCBI-ProteinID: XP_021929392
LinkDB All DBs
Position
Unknown
AA seq 425 aa AA seqDB search
MADLLSCLQWKEEPVSPAGFPDLDSNVTDTWGLFEDEEVQQQKKTLTVPTHTHEKVAEPT
KAEIATRLLQDLDEWIKEEPFSDWLEEKIDLPIFEELPGLESRCYGHNFRDTSKSFPVVT
QVSVMTIPSVIPATAEAKSLPVPQAVVLQDTQSLLREFETVFGEVELTNGTLTPPQSPPV
PPYTSVASKDPKEGELIILQQMIPVQPIPAAPMIPVIYNGERKETLFTLEQMVPGTPSPD
LARELEAVDELVRTRVEHLVDIGSSHCIPDPWESCSSGNNSGSSLGGESEGEASVVAPPS
PCTSSSGSSCGSGEETCDDPEWIPALIQVPPSDCLKNARKRAGSTKPYSRPGIEEKRMRK
KEQNKNAATRYRQKKKAEIEEILGEEKGLEDMNAELQLKASDLSREIKYLKGLMRDLFKA
KGLIK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgatttgctgagctgcttgcagtggaaggaagagcccgtttcccctgcgggcttt
ccagatttagattctaatgtgacggatacatggggattgtttgaagatgaagaggtacaa
caacagaaaaaaacacttactgtcccaacacatacacatgagaaagtagcagaaccaaca
aaagctgaaatagcaacaagacttctccaagatctggatgaatggattaaggaagagcct
ttctcggactggttggaggaaaagatcgacctgccaatatttgaagaacttccaggactc
gagtcccgctgctatggccacaatttccgggacacttccaagtccttccccgttgtgacg
caggtgtctgtcatgacaattccatccgtaatccccgctacagcagaggcaaaatcctta
ccagtgccacaagctgtggtgctacaggacacccagtctttactccgcgagtttgagact
gtgtttggagaagttgagctgacaaatggcaccctcacaccaccacagagtcctccagtc
cccccctacaccagtgttgcttctaaagatcctaaggaaggagaattgataatcctccag
caaatgattcctgttcaaccgattccagcggcgcccatgattcccgtaatatacaatggc
gaacgaaaagaaacgctcttcaccctggaacagatggttcctggaacaccatcaccagat
ctggcccgtgaacttgaagcagtagacgaacttgtccgcacccgcgtcgaacacctcgta
gacatcggcagtagtcactgcataccagatccgtgggaatcatgcagcagtggaaataat
tccggttcaagcctaggaggggaatccgaaggggaagcatctgttgtggcccctcccagt
ccttgcaccagctccagtggcagcagctgtgggagtggggaggaaacatgtgatgaccct
gaatggattccagcattaatccaggtgcctccatcggattgtctgaagaatgcgcgtaaa
cgtgcgggcagtacgaaaccatattcccgccctggaatcgaagagaaacgtatgcgaaag
aaggagcagaataagaatgccgcgacacgttatcgtcagaagaagaaggcggagattgag
gagattctgggtgaagagaaagggctggaagacatgaatgcagagctacaacttaaagct
agtgacttgtcacgggagattaagtacctcaaaggactcatgagagatttgttcaaagcc
aagggactgataaagtga

DBGET integrated database retrieval system