KEGG   Zootermopsis nevadensis: 110835673Help
Entry
110835673         CDS       T05136                                 

Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
zne  Zootermopsis nevadensis
Pathway
zne03410  Base excision repair
Module
zne_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:zne00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110835673
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zne03400]
    110835673
Enzymes [BR:zne01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110835673
DNA repair and recombination proteins [BR:zne03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     110835673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT DNA_ligase_A_C zf-PARP RNA_ligase BRCT_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 110835673
NCBI-ProteinID: XP_021931838
LinkDB All DBs
Position
Unknown
AA seq 959 aa AA seqDB search
QKKFCAERARSGRAVCRKCKNKLDAGALRLAKYGYNPFGPFPMKMWHHVDCLFEVFAGQK
QTTASIKTPDDIEGWSDLEEEDQDEILRHLPKCKGWTRKPKSPAKAGSTKPEMTKTSKGR
HKGKEDSTPPEKESHKDNSFRQFRRLCATLSETESYNEKTAIVRKFFTKGTNGSNFRGDL
HLWCRLLLPGIDKRVYNLQSKQLIKIFSKIFSVDHVEMLMDLERGDVAETVSVFFEQSVC
VQPAKKSVLSLQDVSVMTQRPRSVEPFHSTCLVLRLTSIYPISSWKAFLREYLSLLVLVL
AYPVWDYSFFCCFLIINNIYRCTANDLKMIIRLVKHDLRINAGPKHILGAVNPDAYQAFQ
TSRDLHAVLSKVVEIGDEHSSSSKKSALKITASVMTPILPMLAEACKSVEYGMKKCPNGM
YSEIKYDGERVQVHKKGDEFKYFSRSLKPVLPHKVNTFKDYIPQAFPHGKDLILDSEILL
IDVKTGKPLPFGSLGIHKKNAFKDANVCLFVFDCMYFNGEVLLEKPMKERRRILEENMEE
VPNRIMFSEMKEINDPKDLEEMITKVLKLGLEGLVLKDLMSIYEPGKRHWLKVKKDYLHG
GAMADSADLVVLGAWFGTGHKGGMMSVFLMGCYNPANQKWCTVTKVHTGHDDKTLERLQE
ELDMIKISKEASKVPDWLSCTKTMIPDFVARDPKAMPVWEITGAEFTQHEVHTASGISIR
FPRVTKIRDDKTWETATSLPELKNLFKKSKENEDFSFPSTSRVQSVDRREEDKGSDSCDS
HVGSSGAASAKNSSNRSKDKPSKTSGRSSKHKQQKSSDENIGSVARGGNDVTENGDDESP
AKRRKTVQADSKGKSQFTIKKPLPDVFEGVRVVLPDSVTKDRRELERYFIAYGGELLDPS
DKQESTHVIHVDSTSVENGEGIHVTLSWLWDSIKLLALQKPSRYAVPLPCSAVGLTSFG
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
caaaagaaattctgcgccgaacgtgccaggtcggggcgtgcggtttgcaggaaatgcaag
aataaacttgatgctggtgcccttcggctcgccaagtatggctacaacccttttgggcca
ttccccatgaagatgtggcaccacgtggattgcctgttcgaagtgttcgctggtcagaag
cagaccacagccagcatcaagaccccggatgacatcgagggctggagtgatttggaagaa
gaagaccaagatgagatactgaggcacttgccgaaatgtaaaggctggacgcggaaacca
aaatcaccagctaaagctgggtcgacgaagccagaaatgacaaagacatccaaagggaga
cacaagggaaaggaggattccactcctccagaaaaagaatctcataaagataactccttc
aggcagttcaggagattgtgtgctacgttgtcagagacagagagttacaatgagaagaca
gcaattgtcaggaagtttttcaccaagggcacaaatggctcgaacttcagaggggacctt
cacttatggtgtcgtcttttgctgcccggcattgataaacgcgtgtataatctacagagc
aaacaactgatcaagattttcagtaagatcttttccgttgaccacgtggagatgctcatg
gatttggagcgaggcgatgtagcggagactgtgagcgttttctttgagcagagcgtatgt
gtgcagcctgccaagaagagtgttctgtccttgcaagatgtgagtgttatgacgcaaaga
cccagaagtgtggaaccttttcactccacttgtcttgttttgaggctaacatctatttat
ccaattagcagttggaaggctttcctcagggagtatctgagtcttctagtattggtactt
gcgtatcctgtgtgggattactcatttttctgctgctttcttataataaacaatatttac
agatgcacagccaatgacttgaaaatgattatccggctagtgaaacatgacctccgcatt
aatgctggaccaaaacatattttgggtgctgtgaatccagatgcttaccaagcatttcag
acatcacgtgacttacatgctgttctgtcaaaagttgtcgagattggtgatgagcatagc
tcctcttcgaagaagagtgctctcaaaataacagcctccgtcatgactccgatcctaccc
atgctggctgaggcttgtaaatctgttgaatacggaatgaagaaatgcccaaatggaatg
tattcagaaattaaatatgacggtgaacgggtccaggtacataagaagggggatgaattc
aaatacttttcacggagtcttaagccagttttgccgcataaggtgaacacgttcaaagac
tacattcctcaagcattcccgcatgggaaagatcttatactggacagcgaaatccttctg
atagatgtaaagactggaaaaccattgccgtttgggagtttgggaattcacaagaaaaat
gcttttaaggatgcaaatgtgtgtctctttgtatttgactgcatgtacttcaatggcgaa
gtgcttcttgaaaaaccaatgaaggaaagaagaagaatattggaggaaaacatggaagaa
gttccaaatcgcattatgttttctgaaatgaaagaaattaatgatccaaaagacttggaa
gaaatgatcacaaaagttttaaaacttggactggaagggttagtgcttaaggatttaatg
agtatatatgaacctggcaaaagacactggctgaaggtgaagaaggattatttacatggc
ggagcaatggctgacagtgcagaccttgtggtgcttggcgcctggtttgggactggacac
aaaggtggcatgatgtctgtgtttttgatgggttgttacaatcccgctaaccagaaatgg
tgcacggttaccaaagttcatactggacatgatgacaaaacactggagagactgcaggaa
gaacttgatatgattaaaatcagcaaggaagcttctaaagtgcccgactggctttcttgc
accaagactatgattcctgattttgtagcaagagatcccaaggcaatgccagtttgggaa
atcacaggtgcagaatttactcaacacgaagttcacacggcttctggcatctctatccga
tttccacgggtaacgaagatccgtgatgacaaaacgtgggaaactgccacttcacttcct
gaactaaagaatttatttaagaaatctaaggagaacgaggatttctccttcccctccaca
tctcgcgttcaaagtgtagatcgacgtgaggaagacaaaggcagtgacagttgtgattct
catgtggggtcttcaggagctgcttctgcaaagaattcaagtaaccgatccaaagataag
ccgagcaaaacttcaggacgaagctctaaacataaacaacagaaatccagcgatgagaat
attggatctgttgcccgtggcggtaatgacgtaactgagaatggggatgatgaatcacct
gcgaagaggaggaagacagtacaggctgactcaaaaggaaaatctcagtttaccatcaag
aagccgctgccagacgtgtttgaaggcgtcagggtggtcctgccggactctgtcaccaag
gatcgccgcgaactggaacgatacttcatagcatatgggggagaactcctggatccatct
gacaagcaggaatcgacccacgttatccacgtggacagcacatccgttgagaacggagag
gggattcacgtgaccttgagctggctgtgggactccataaagctactagcgctgcagaaa
cccagtcgatacgccgtccccctgccctgcagcgcggtcggcttgacgtcgttcggataa

DBGET integrated database retrieval system