KEGG   Zootermopsis nevadensis: 110836715Help
Entry
110836715         CDS       T05136                                 

Definition
(RefSeq) probable maltase-glucoamylase 2
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00052  Galactose metabolism
zne00500  Starch and sucrose metabolism
zne01100  Metabolic pathways
zne04142  Lysosome
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110836715
   00500 Starch and sucrose metabolism
    110836715
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110836715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zne04147]
    110836715
Enzymes [BR:zne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110836715
Exosome [BR:zne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110836715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil
Motif
Other DBs
NCBI-GeneID: 110836715
NCBI-ProteinID: XP_021933895
LinkDB All DBs
Position
Unknown
AA seq 959 aa AA seqDB search
MKLQKTVYIQEGHGEEPSSHYEAPLDKEELVPRPQQNSLCTPMRTCYTCVILVLAVVVPV
VTFFAVFSNNPEFQPEPWTCNVKADHRVPCATEKTETACLQASCCWNGIDLACFHSIPSQ
YSYSVKDWKNNKWAVNELETANLSLTSRMETSPYGRPVERLLHTLVVATSADHLRLYIYS
ETDKPEDTERIPLNSSRFRAEVYGPEYYSLQIYRQEDSSSLLFSTSRGPVIASENYWELS
LQFPKEAALFGLGGVRLSSKPKLLYSSGHRLSANPFIIVVETDGSAYGILFNSTGPLEFQ
LLENSNLLIVKSLSTVRWDFSVFAGPTPADVMHQYTSADGLHPVLPPSWVLGLHICRDTA
KDNETLAAEDALYFIKEAMATGLPYESDCLQEGLLYQMSFTIPESMEHVIEEIQRMQRRI
LLSLPPHVNSSLVTIDELFVLTEDQQVLSQEYHSLNVSYPDFFNEVTGTWFRENLNNLMT
GREDVVGGFVLQDNWPAVNTTEDKTENMVYVPEGTLSRGTLWWEVRHGSTPHYKLHNKYS
LQNAKSVASSLQLEKHLVLTAATYTGSGTVGGSHAHTQADVACTWSNMKDALEMALGQGL
AGIPLAGGGSVCGTTGSYDDELCIRWYLMSSMLPLMRVSSEMPLRDPVNLKFGYAREAVK
RALALRYSLLAYFYSLFHNASSEGVPIARPMFFDFPSDNKTWTENEQFMVGPALLVRPAF
YKNAVSVPVYLPNENTTWYHFGGGHKVNNGTGEVTVGVTSLDKELVLLLRGGFIVPVQKA
KPTVSETLSGPYNLVVGLKCNENGTCSAFGDLTVDSNIKFTFSATERELSFQSVCVNTTS
SSTLENISVYGLNMTACLNVSSSFNTGASCAVAEGNQILEITDLQLDLCSKGDGQIHWEV
TDIPQSTTTIKPETSTINPETTTKPKTTEPETTEPKTTEPETTEPKTTEPETTETETTN
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacaaaaaactgtgtatattcaggagggacacggggaagaaccctcctcccac
tatgaagcccccctggacaaggaggagctggtgccgagaccacagcagaattccctgtgc
actccaatgcgaacttgctacacgtgcgtgatcctggtgctggcagtggttgttcctgtc
gtcaccttcttcgctgtcttctccaacaaccctgagttccagccagagccatggacatgc
aatgtgaaggctgatcacagggttccatgtgcgacagaaaaaactgagacagcgtgtctg
caagctagctgctgctggaatggcatcgacctagcatgcttccattcgattccctcccag
tacagctacagcgtcaaggactggaagaacaacaagtgggcagtcaatgaattggagaca
gcgaacctgagtctcacaagccggatggagacttcaccttatggcagacctgtagagcgg
ctactccatacccttgtggtagccacctcagcagaccacctccggttgtacatctacagt
gagacagacaaaccagaagacacagaaagaatcccactgaactcatcgagattcagagca
gaagtatatggtccagaatattactcattgcaaatatatcgccaagaggatagcagctca
ctcctctttagtacctcacgaggtcctgtgattgccagtgaaaattactgggagctgtca
ctgcagttcccaaaggaagctgctctgtttgggttgggaggcgtacgactttcttcaaaa
cccaaactcctatacagcagtgggcacagactcagtgccaaccctttcatcatagtcgtc
gaaactgatggaagtgcctacggaatcctatttaacagcacgggaccgctagagttccag
ctgttggaaaactctaatcttctgatagtgaaatctctttccacggtgaggtgggatttt
agtgtcttcgcaggtcctactcctgcagatgtgatgcaccagtacacctcagctgatgga
ctacaccctgttctgccgccttcctgggtgctaggactgcatatctgcagggacacggca
aaggacaatgaaactctcgctgcagaagatgctctgtatttcataaaggaggccatggca
actgggttaccatatgagtcagactgcctgcaagaaggtcttctgtatcagatgagtttc
acgataccagagagcatggaacatgtcatcgaggagattcaaaggatgcaacggagaatt
ttattatctcttcctcctcacgtaaattcatccctggtgacaattgacgagctgttcgta
ttgaccgaggatcagcaggtgctttcacaagagtatcacagcctgaatgtttcttaccca
gacttcttcaatgaggtaacaggaacatggtttagagaaaacctgaacaatctgatgaca
ggaagagaagatgttgtgggaggtttcgtgctgcaggacaattggcccgccgtcaacacc
acggaggataagacagagaacatggtgtatgtgccagagggcacattgtcacgcggaaca
ctgtggtgggaggtccgccacggaagcacaccccattacaagctgcacaacaaatacagc
ctgcagaatgccaaatcggttgcatccagtctgcagctagagaaacatctagtgctaact
gcagccacatacacagggagcggcactgtgggcggaagccacgcacacacgcaagccgat
gtggcatgcacgtggagtaacatgaaggatgctctggagatggcactgggtcaaggatta
gcaggaatcccactggcaggcgggggttctgtctgtggcacgacgggtagctacgacgac
gagctctgtatcagatggtatctcatgagttccatgcttcctttaatgcgcgtatcatct
gagatgcctctacgagacccagtgaacctcaaatttgggtatgctcgtgaggccgtaaag
agggccctggccttgaggtactcgctgctggcatacttttactccctcttccataacgca
agcagcgaaggggttccgatcgcaagacccatgttttttgatttcccaagtgacaataag
acatggacagaaaatgagcaattcatggttggcccagcacttctggttcgtcctgccttt
tacaagaatgcagtttcagtgcctgtgtaccttccaaatgagaacacaacttggtaccat
tttggagggggtcataaagtgaacaatggcacaggggaggtaacagtcggtgtcacgagc
ctagacaaggagttggtgcttctgctaagaggtggcttcattgtgccagtgcagaaagcg
aagccaaccgtcagtgaaactctctcaggcccttacaacttagttgtcggtcttaaatgc
aatgaaaatggcacatgtagtgcattcggtgatcttacggtggattccaacatcaaattc
accttcagtgccactgaacgtgaactgagcttccagagtgtgtgtgtcaacacaacctcc
tcttctaccctggagaatatatcagtatatggacttaacatgacagcatgtctgaatgtc
agcagtagcttcaacactggagcaagctgcgctgtcgcagaaggaaaccaaattctggaa
atcacggatttacagcttgatctgtgcagtaaaggggacggtcaaatacactgggaagtt
actgacattccacaatcaacaacaacaataaaacctgaaacatcaacaatcaatcctgaa
acaacaaccaagcccaaaacaactgaacctgaaacaactgagcccaaaacaactgaacct
gaaacaactgagcccaaaacaactgaacctgaaacaactgaaaccgaaacaacaaattaa

DBGET integrated database retrieval system