KEGG   Zootermopsis nevadensis: 110837138Help
Entry
110837138         CDS       T05136                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
zne  Zootermopsis nevadensis
Brite
KEGG Orthology (KO) [BR:zne00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:zne01002]
    110837138
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zne04147]
    110837138
   04090 CD Molecules [BR:zne04090]
    110837138
Enzymes [BR:zne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     110837138
Peptidases [BR:zne01002]
 Metallo Peptidases
  Family M2
   110837138
Exosome [BR:zne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110837138
CD molecules [BR:zne04090]
 Proteins
  110837138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 110837138
NCBI-ProteinID: XP_021934673
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MRCVVSIPIVIAFLQLALGYTQERRYVEGSNMNLGEALQFLREYDREASGMCFRVTSSQW
NYSTNITETNKRRMLEEQALSAKFQRLSWRRATSYTWTRLPDPIVRRQLHMLAIEGRTAL
PEEKFNELQQLVTEMKEIYSRARICPHSLNNINYNYRQSGNCDLALDPDLTRIMSHSRDY
EEQLHVWQAWRDTVGPPIRSKYIRYVQLANHAARLNGFHDAGQQQRESYEDSEINTQLTE
LWATLAPLYRELHAYVRRRLVERYGSEHVRPDGPLPAHLLGNMWAQNWRNLADLVIPFPA
KSTVDVSSEMLRQGYTPLRMFHLAEEFFTSLGLKPMPPEFWHHSMLEKPLDREVACRASA
WDFCNHKDYRIKQCTTVSLEDLLTIHHEMAHIQYYLQYADQPLLFRDGANPGFHEAVGDV
ITLSVSSPRHLQGIGLLNNVTDEYETGINFLMLMALEKVAYLPFAYIVDQWRWGLFAGDW
NIDEMNARWWELRLRHQGIIPPIPRTEKDFDPASKYH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagatgtgtagtgtccataccaatagtgatagcatttctgcagcttgcactgggctac
acacaagagagaagatatgtagagggttcaaatatgaatttgggcgaggcacttcagttt
cttagagaatatgatcgggaagcatctggaatgtgttttcgagtcacatcatcccaatgg
aactatagtaccaacatcacagaaacaaataagcgtcgtatgttggaggaacaagcattg
agtgcgaagtttcaacgcttatcatggagaagagctacatcgtatacgtggacgcggtta
ccagatcccatcgtcagaaggcagctacacatgttggccatagagggaagaactgcactc
ccagaggagaagtttaatgaactacagcaactggtaacagaaatgaaagagatttactca
agagcacgtatttgtccacactcgcttaacaatattaactacaactacaggcagagcgga
aattgtgatcttgcacttgatccagatctgactcgcatcatgtctcattcacgggactat
gaagaacagttacatgtgtggcaagcatggcgtgatactgtgggacctccaatcagaagc
aagtatattcgttatgttcaactagcaaatcatgcagctagattaaatggtttccatgat
gcagggcagcaacagagagagagttatgaggactcagaaattaatacccaactaacagag
ctctgggcaactttagcaccactttacagagagctgcatgcttacgtaaggcgtcgactt
gtggagagatatggttctgaacatgtgagacctgatggaccactaccagcacatctgtta
gggaacatgtgggcacaaaactggcggaacctagcagacctggtgatcccatttccagca
aagtcaacagttgatgtatcttctgaaatgttgagacaaggatatacaccactcaggatg
tttcacctggctgaagaattcttcacatcattaggacttaaaccaatgcctcctgaattc
tggcaccattcaatgcttgagaaacctctagacagagaagtagcttgtcgagcatctgca
tgggacttctgtaatcacaaagactacaggatcaaacagtgtactactgtctcattggag
gacttgctaactatacatcacgagatggctcatatccagtactacttacaatacgcagac
caacccctgttgttcagggatggagctaatcctggtttccatgaggcagtgggggatgta
atcactttatcagtttctagtcctcggcatttgcaaggaattggactccttaataatgtc
actgatgaatatgaaactggtataaacttcctgatgttgatggctcttgaaaaagttgca
taccttccatttgcctatattgttgatcagtggcgttggggattgttcgctggagactgg
aatattgatgaaatgaatgcacgctggtgggagctgcggttaaggcatcaaggaatcata
cctcctattccacgaactgagaaggattttgaccctgcttccaaatatcat

DBGET integrated database retrieval system