KEGG   Zootermopsis nevadensis: 110838650Help
Entry
110838650         CDS       T05136                                 

Definition
(RefSeq) phosphoenolpyruvate phosphomutase-like isoform X1
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00440  Phosphonate and phosphinate metabolism
zne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    110838650
Enzymes [BR:zne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     110838650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-GeneID: 110838650
NCBI-ProteinID: XP_021937720
LinkDB All DBs
Position
Unknown
AA seq 332 aa AA seqDB search
MTSQTLCQTYLGNMAHKTRLLNGGKNLVRNLVLGRSVSTSSKRKTTLLKQLLSSPQLAFL
MEAHSGLSARIVEEAGFHGIWGSGLSISAQLGVRDSNEASWTQVLEVAEFMADATHIPIL
LDADTGFGNFNNARRLVRKLEDRGIAGCCIEDKCFPKTNSLLDGRQQPLADIQEFTLKIK
ACKDHQRDPDFCVVARVEAFIAGWGLQEALTRAEAYRNAGADAILIHSKKSDPSDIEAFM
SQWGNKCPVMIVPTKYFKTPTEHFKELGISTVIWANHNLRASVSAMQNTCHQIMSEQSLV
NIESKVASITEIFRLQQDHELRAAENLYLPKK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtcaaacactgtgtcaaacctacttaggaaatatggcccacaagacacgactc
ctcaatggtggcaaaaacctggtccgaaatttagtgttgggcaggtcagtaagcacatca
agcaagcggaagactactctgctaaaacaactgctcagctcaccacaactcgccttcctc
atggaagcacactctggcctgagcgctcgcattgtggaggaagcagggtttcatggcata
tggggcagtggactgtccatctcagcccaactgggtgtcagggatagcaatgaagcttcg
tggacacaggtcctggaagtggccgagttcatggctgatgcaacacacattcccatcctc
ctagatgcagacacaggctttggaaattttaacaatgcacgaagacttgtgcgtaagttg
gaagaccgtggcattgcaggctgctgcattgaagataaatgcttcccaaagacaaactct
ttattagatggaagacaacaaccactagcagacattcaagaatttacacttaaaattaag
gcttgtaaggaccaccaacgagacccagatttctgtgtagtggcgagagttgaagccttc
attgctggctggggcctgcaagaagctctaactagagcagaagcttacagaaatgctggt
gctgatgccattctcattcacagcaagaagtctgacccctctgatattgaagctttcatg
tctcagtggggaaacaagtgtccagttatgattgttccaactaagtacttcaaaactcca
acagaacactttaaagaacttggcatctcaactgtaatctgggcaaaccataacctccga
gcatctgtcagtgctatgcagaatacctgtcatcagatcatgtcagaacagtctctggtg
aatattgaaagcaaggtagccagcataacagaaattttcagactacaacaagatcatgag
ctaagagcagctgaaaatttgtatctgccaaagaaatag

DBGET integrated database retrieval system