KEGG   Zootermopsis nevadensis: 110840631Help
Entry
110840631         CDS       T05136                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00020  Citrate cycle (TCA cycle)
zne00190  Oxidative phosphorylation
zne01100  Metabolic pathways
zne01200  Carbon metabolism
Module
zne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
zne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
zne_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110840631
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110840631
Enzymes [BR:zne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110840631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 Catalase_C HI0933_like
Motif
Other DBs
NCBI-GeneID: 110840631
NCBI-ProteinID: XP_021941488
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MSGMIKLPAILAKNVTTNTLSAVGRPVIAARKIHFTVDGKQTEAKVSQISRDYAVVDHTY
DAVVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEQDNWQWH
MYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGKXIETLQAFDIHQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGQSLRYDCNYFVEYFALDLLMEDGECRGVIALCLEDG
SIHRFQSKSTVLATGGYGRTFFSCTSAHTCTGDGTAMVSRAGLYNQDLEFIQFHPTGIYG
AGCLITEGCRGEGGYLINGEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKD
HVFLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVL
TVSGGKDAVVPGLYACGEAASSSVHGANRLGANSLLDLVVFGRACAKTIAEENKPGESIG
SLKANSGEVSVANLDHLRHADGPLTTAALRLNMQKTMQAHAAVFRTAETLQEGVKKMQGL
YKKLDDLKVSDHSLIWNSDLVETLELQNLMLNAMQAIVAAENRKESRGAHAREDFKERID
EYDYSKPTQSQTKRPYEQHWRKHTLTSINSKTGDVQITFRPVIDITLDAQECSSVPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaatgattaaactgccggcaattcttgcaaagaatgtgacaaccaacacgttg
agcgcggttggccgaccagtaatcgcagcccgaaagattcattttacagttgatggaaag
cagacagaagccaaagtctcccagatttctcgagactatgcagtggtggaccacacttat
gatgcagtggttgttggtgctggtggggcagggctccgggcagcctttggtcttgttgca
gaaggattcaagacagctgttattacgaaattatttccaactcgatcacatacagttgct
gctcagggtggtatcaatgctgctcttggaaacatggagcaagataactggcagtggcac
atgtatgatacagtgaagggttctgattggttgggagaccaagatgcaattcattacatg
acaagagaagcaccaaaagctgtgattgagcttgagaattatggtaaatagatagagact
ttgcaggcatttgatatacaccagcgagcatttggaggacagtcactcaagtttggtaaa
ggaggtcaagcccatcggtgttgttgtgtagcggatcgaactggccactcactcttacac
acgttatatggccagtctttaagatatgactgcaactattttgttgaatattttgctctt
gacttgctgatggaagatggtgaatgtcgtggagtaattgccctgtgtttggaagatgga
agtatccataggttccagtcaaagagcacggttttggcaactggaggctatggtcgaact
tttttctcgtgtacttcggcccacacatgcacaggtgatggtacagctatggtatctaga
gcagggctctataatcaagacttagagtttatacagttccacccaacaggtatttatgga
gctggttgcctcatcacagaaggttgtcgtggagaaggaggatatctgatcaatggtgaa
ggtgaacggttcatggaacgttatgctcccgtagcaaaagacttggcttctcgtgacgtt
gtatcaaggtccatgactattgaaatcagagaaggaagagggtgtgggcctgagaaagat
catgtgttccttcagttgcatcatctgccaccagagcaactggctgctagacttcctggc
atctcagaaacagccatgatctttgctggtgttgatgtgacacgtgaaccaattccagtg
ctgccaacagttcactataacatgggtggcgtccccaccaattacagaggacaagtgttg
actgtttctggaggaaaggatgcagttgtaccaggtctttatgcctgtggtgaagcagcc
tcctcatcagtacatggtgctaatcgtcttggtgccaactcattgcttgaccttgttgtt
tttggacgtgcctgtgcaaagaccattgcagaggaaaataaacctggggaatccattggt
tctctcaaagctaattctggtgaagtatcagttgcaaatttagaccatttgcgacatgct
gatgggcctctgactacggcagctttgcgtctaaacatgcaaaagacgatgcaggctcat
gcagctgtatttaggacagctgagactcttcaggaaggtgtgaagaaaatgcaaggactg
tataagaagttggatgacctgaaagtttctgatcacagtctgatctggaactcagatttg
gtggagactttggaactacagaatctcatgctgaatgccatgcaggccattgtcgcagct
gagaacaggaaggagtcacgtggtgcccatgctcgcgaggatttcaaggaaagaatcgat
gaatatgactactcgaaaccaactcagtcacagacaaaacgaccatatgagcagcactgg
agaaagcatactcttacatctatcaactccaagactggtgacgttcagatcacattcaga
cctgtcattgacatcacattggatgcacaagagtgttcaagtgtgcctccagctattcgt
tcttattaa

DBGET integrated database retrieval system