KEGG   Zootermopsis nevadensis: 110840923Help
Entry
110840923         CDS       T05136                                 

Definition
(RefSeq) angiotensin-converting enzyme-like isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
zne  Zootermopsis nevadensis
Brite
Enzymes [BR:zne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     110840923
Peptidases [BR:zne01002]
 Metallo Peptidases
  Family M2
   110840923
Exosome [BR:zne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110840923
CD molecules [BR:zne04090]
 Proteins
  110840923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 110840923
NCBI-ProteinID: XP_021941937
LinkDB All DBs
Position
Unknown
AA seq 675 aa AA seqDB search
MEAAIDRHLESIVESSLQLQHTQPENINCNVEVYVLMWQFAVLLATVSAVALSGINPDIK
KQQIQDEELQAQKYLDYVENEFNRRANRASLVRWAYASNITDANLKNQLAVMEEDAKFVK
KKWKDTIKYPWTTFKDYDIRRKFKKHSVLGYAALEGPKLGKYMQLVSDMSSIYSKAKICD
YKNPKKCDLSLEPDLVEILRTSRDPEELKHVWVEWRKASGEKCRGMFEHYVALSNEAATL
NNFTDTAEYWLKDYESPDFRDQVSRLWDQVQPLYLQIHAYVRRKLRETYGEKLVTRRGPI
PAHLLGNIWTQLWGNIQSISAPYPDKSTIDVTSTMVKQGYTPLKMFKLAEEFFISLNLSA
MPETFWERSILEKPMDRDLICHASAWDFHDGKDFRIKQCTRIVTDDLFTAHHEMGHVQYF
IQYKDQPVAYKDGANPGFHEAVGDVIALSVLTPKHLREIGLLEGDASTGEDYEATINYLY
LQGLQKIVFIPFAYLMDLWRWDVFKGHITSKNYNCEWWKLRHKYQGIDPPVDRTEEDFDP
GAKFHIIANVPYIRYFVSFVIQFQFHRSLCKKAGQFDPNNPKKPLHECDIYRSTEAGNLL
REMLQMGSSKPWPDAMEVLSGQREMDASGMLEYFKPLTEWLEKNNKQFGEHIGWEPSHKL
CTKTRSELSTLRVKD
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgcgatagatcgacatcttgaatcgatcgtcgaatcttcgctacagttacag
cacacacagcccgagaacattaattgcaatgtggaggtttacgttctaatgtggcagttt
gctgtgctcctggcgacagtctccgcagtagctctgtcggggattaaccccgacattaag
aagcaacaaattcaagacgaagaattgcaggcacagaaatacttagattatgtggaaaac
gaattcaatagacgagccaacagagcgtcactggttaggtgggcgtatgcatctaatata
acagatgcgaatcttaagaaccagttagctgttatggaagaagatgccaagttcgtgaaa
aagaaatggaaggatacaatcaaatatccttggactacattcaaggactacgatattcga
cgaaagtttaagaagcactcagtacttggctacgctgctctagaaggacctaaacttgga
aagtatatgcaactggtgtctgacatgtcctccatctacagcaaggcgaagatctgtgac
tacaagaaccccaagaaatgtgatctcagtctggaaccagatctggtggagatcctgagg
acgagcagggaccccgaagagttgaaacacgtatgggtggaatggcggaaggcgtcgggc
gagaagtgccgggggatgttcgagcactacgtagctctcagcaacgaagcggcgaccctc
aacaacttcactgacaccgccgagtactggcttaaggattacgaatctcctgacttcaga
gaccaagtgtcgcgtctttgggaccaggtgcagcctctgtacctccagatacacgcgtat
gtgaggaggaaactgcgagaaacttacggcgagaaactcgtcactcgtcgtggacccata
ccagcacatcttctaggtaatatatggactcagttatggggtaacattcagagcatttct
gcaccatatccggacaaatctaccatcgacgtaacttcaaccatggttaaacagggttac
actcctctgaagatgtttaaactcgcggaggaattcttcatatctctcaatcttagtgcg
atgccagaaacattctgggagagatccattttggagaaaccaatggacagagacttaatc
tgccacgcctcggcctgggactttcatgatggcaaagacttcaggatcaaacaatgcacc
aggattgtcacggacgatcttttcactgcccaccacgaaatggggcacgtgcagtatttc
atccagtacaaagatcaaccagtggcttacaaagacggagctaatccagggtttcacgaa
gctgttggagatgtgatagcgctgtccgttttaacacccaaacacctgcgagagatcggg
ttgctggaaggcgatgcatcaactggtgaagattacgaggctaccattaattatctgtat
ctgcagggactgcagaaaatagtattcattccttttgcgtatctgatggacttgtggaga
tgggacgtcttcaagggacacattaccagcaagaactacaactgtgagtggtggaaactc
aggcacaagtatcaaggaattgatcctccagtggacagaacggaggaagattttgatcca
ggtgcaaagttccacataatagccaacgttccatacatcagatactttgtaagcttcgtc
atccaattccagtttcacagaagtctgtgcaaaaaagctggtcagtttgaccccaataat
ccgaagaaaccacttcatgaatgtgacatctatcgaagtactgaggccggaaatcttcta
cgagaaatgttgcagatgggttcatcaaaaccttggccggatgcaatggaagttttgtcg
gggcaaagagagatggacgccagtggaatgctggaatatttcaaacccctcacagaatgg
ctggaaaagaataacaagcagtttggagaacatattggctgggagccaagtcataaactt
tgtaccaaaacaagatcggaactgtccaccctcagggtcaaggattag

DBGET integrated database retrieval system