KEGG   Zoogloeaceae bacteirum Par-f-2: C3497_01015Help
Entry
C3497_01015       CDS       T05440                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
zpa  Zoogloeaceae bacteirum Par-f-2
Pathway
zpa00030  Pentose phosphate pathway
zpa01100  Metabolic pathways
zpa01120  Microbial metabolism in diverse environments
zpa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C3497_01015
Enzymes [BR:zpa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     C3497_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AVZ78206
UniProt: A0A2U3TKZ2
LinkDB All DBs
Position
221523..223370
Genome map
AA seq 615 aa AA seqDB search
MAWTRKILRVNLSAGTCSAEALNMKWADEYLGSRGLATKYLVEEIDPKVDPLSPDNKLIM
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGFFGAEMKFAGWDMIIFEGKSPKPVY
LYVENDRAELRDAAHLWGTSCWHTEETIKKELQDPLVRVSSIGRAGENQVLFACVVNDLH
RAAGRSGVGAVMGSKNLKAVALRGTRGVGGIRDFPAFMKAVNDGKKVLADNAVTGQGLPK
YGTQVLMNVINEIGALPTRNHRDVQFEDAAKISAEAMHEKRPTDGKPHLVTNAACFGCTI
ACGRISEIDKGHFTVVNKPEYWGASGGLEYEAAWALGAANGVGDLEALQYANLLCNEHGM
DPISFGATVGAVMELYEMGAISKDELGIEAPFGSAAALARLAEMTARGEGFGKVIGLGSK
RLCEKYGHPELSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPHTTEGKPALVKAFQDATAVFDSAGICIFTSFAWSLADVQPQLQAACEGDWSMDKLHQ
VGERIWNMERQFNLAAGLTAKDDNLPPRLTSEPAKTGPAKGLVNQLDKMLPEYYQLRGWN
ADGVPTADTLQRLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcctggacccgcaagatcctgcgtgtgaatctcagcgcgggcacctgcagcgccgaa
gcgctgaacatgaagtgggccgatgaatatctcggctcgcgtgggcttgccaccaagtac
ctggtggaagagatcgacccgaaggtcgatccgctgtcgcccgacaacaagctgatcatg
gccaccggccccctgaccggcaccatggcctcgaccggcggacgctacaccgtggtcacc
aaggggccgctgaccggcgcgatcgcctgctcgaactcgggcggctttttcggtgccgag
atgaaattcgccggttgggacatgatcatcttcgaaggcaagtctccgaagccggtctat
ttgtatgtcgaaaacgaccgcgccgaactgcgcgatgccgcccatctgtggggcaccagc
tgctggcacaccgaggaaaccatcaagaaggaactacaggacccgctggtgcgggtgtcg
tcgattggccgtgccggcgagaaccaggtgctgttcgcctgcgtggtcaacgacctgcac
cgcgcggccggccgctcgggcgtcggcgcggtgatgggctccaagaacctgaaggcggtg
gcgctgcgcggcacccgtggcgtcggcggcatccgggattttccggccttcatgaaggcg
gtcaatgacggcaagaaggttttggccgacaacgcggtcaccggccaggggctgcccaag
tacggcacccaggtgctgatgaacgtgatcaacgagatcggcgcgttgcccacccgcaac
caccgcgatgtgcagttcgaggacgccgccaagatctctgccgaggcgatgcacgaaaag
cgccccaccgacggcaagccgcacctggtcaccaatgccgcgtgcttcggctgtacgatc
gcctgcgggcgcatttcggaaatcgacaaaggccatttcaccgtggtcaataagcccgaa
tactggggcgcctcgggcgggctggagtacgaagcagcctgggcgctcggtgcggccaac
ggcgttggcgacctcgaggcactgcagtacgccaacctgctgtgcaacgagcacggcatg
gacccgatctcgttcggcgcgacggtcggcgcggtcatggagctgtacgaaatgggcgcg
atcagcaaagatgagctcggcatcgaagcgcccttcggctcggccgccgcgctggcccga
ctggccgagatgaccgcccggggcgaaggctttggcaaggtgatcggcctgggcagcaag
cgcctgtgcgagaaatacggccatccggaactgtcgatgagcgtcaagggccaggaattc
ccggcctacgattcgcgcggcatccagggcatggggctggcctatgccacctccaaccgc
ggcgcctgccatctgcgcggctacacggtggcctccgaggtactgggcattccggtcaag
accgacccgcacacgaccgaaggcaagccggcgctggtcaaagcttttcaggacgctacc
gcggtgttcgactcggccggcatctgtatcttcacctcgtttgcctggagtctggccgat
gtgcagccccagttgcaggccgcttgcgagggcgactggtcgatggacaagctgcatcag
gtcggcgagcggatctggaacatggagcgccagttcaacctggccgccggcctgaccgcc
aaggacgacaacctgccgccgcgcctgacctcagagccggctaagaccgggccggccaag
gggctggtcaaccagctcgacaagatgctgcccgagtattaccagttgcgcggctggaat
gccgacggcgtgcccaccgccgatacgctgcaaaggctgggtttgtag

DBGET integrated database retrieval system