KEGG   Zoogloeaceae bacteirum Par-f-2: C3497_02620Help
Entry
C3497_02620       CDS       T05440                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
zpa  Zoogloeaceae bacteirum Par-f-2
Brite
KEGG Orthology (KO) [BR:zpa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C3497_02620
Enzymes [BR:zpa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C3497_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 NAD_binding_8 FMO-like K_oxygenase Thi4 Glutaredoxin NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AVZ78481
UniProt: A0A2S0QUM1
LinkDB All DBs
Position
544390..545949
Genome map
AA seq 519 aa AA seqDB search
MLDANIKTQLKAYLERVTQPIEIVASLDDSPKSHEMLELLHDVVEQSKLITLIERRDDDE
RKPSFTVGPRGSEARVRFAGLPMGHEFTSLILALLQSAGYPPKVDPEVIEQIKQLEGEFN
FETYVSLSCHNCPDVVQALNLMAILNPNIRHTMIDGALFQSEVEARQIMAVPTVYLNGQE
FGQGRMELAEILAKVDSGAAARDAKKLSEKPAFDVLVIGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVMDTLGIENFISVKYTEGPKLVASLEEHVKEYEVDVMNLQRVAALVPGENLH
QVQLENGAVLQAKAVIIATGARWREMNVPGEKEFRGKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGVVAHVTLLEFADTLRADAVLQKKLYSLPNVTVIKNAQTTEVTGTDKV
NGLVYKDRLSGQMQRIELEGVFVQIGLLPNTDFLKGTLELTRFGEVVVDVKGQTSVSGVF
AAGDCTTVPYKQIVIAMGEGAKAALSAFDHLIRSSAPVA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatatcaagactcaactgaaagcctacctggaacgggtgacgcagccg
atcgagatcgtggcgtcgctcgacgacagccccaaatcgcatgaaatgctggaactgctg
catgacgtggtggagcagtccaagttgatcaccctgatcgaacgccgcgacgacgatgag
cgcaagccgtcgtttaccgtcggcccgcgcggtagcgaggcgcgtgtgcgttttgccggt
ttgccgatggggcacgaatttacctcgctgatccttgcgttgttgcagtcggccggttat
ccgcccaaggtcgatccggaagtgatcgaacagatcaagcagctcgaaggcgaattcaac
ttcgaaacctatgtgtcgctgtcttgccacaactgcccggacgtggtgcaggcgctgaac
ctgatggctattctcaatccgaatatccgtcacaccatgatcgacggggcgctgttccag
tccgaagtggaggcgcgtcagatcatggcggtgcccacggtgtatttgaacggccaggag
ttcggccaagggcgcatggagctggcggaaattcttgccaaggtcgacagcggtgcggcg
gcccgcgatgccaaaaagctctcggaaaagccagccttcgatgtgctggtgatcggcggc
ggcccggccggtgcggcggcggcgatctacgcggcgcgcaaaggtatccgtaccggcgtg
gtggccgagcgtttcggcggtcaggtcatggataccctgggcatcgaaaacttcatttcg
gtgaagtacaccgaggggccgaagctggttgccagcctggaggagcacgtcaaggagtat
gaggtcgacgtgatgaatctgcagcgggtggcggccttggtgccaggggaaaatctgcac
caagtgcagctggaaaacggcgcggtactccaggccaaggcggtgatcattgccaccggc
gcgcgctggcgcgagatgaatgtgccgggcgaaaaagaattccgcggcaagggtgtggcg
tattgtccgcactgcgacggcccgttgttcaaaggcaagcgcgtggcggtgatcggtggc
ggcaactcgggcgtggaggcggccatcgacctggcgggcgtggtcgcgcatgtcaccttg
ctggaatttgccgacaccctgcgtgccgatgcggtgttgcagaaaaagctctacagtctg
cccaatgtcacggtgatcaaaaacgcgcagaccaccgaagtcaccggcaccgacaaagtc
aacggactggtgtataaagaccggctgtcgggccaaatgcagcgcatcgagctggagggc
gtttttgtgcagatcggtctattgcccaacaccgattttctcaagggtacgctggagctg
actcgctttggcgaggtggtcgtcgacgtcaaagggcagaccagcgtctccggggtgttt
gccgccggagattgcaccacagtgccctacaagcagatcgtcatcgccatgggtgaaggc
gccaaagccgcgctgtcggccttcgatcatctgatccgcagcagcgccccggtggcctga

DBGET integrated database retrieval system