KEGG   Zoogloeaceae bacteirum Par-f-2: C3497_11950Help
Entry
C3497_11950       CDS       T05440                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zpa  Zoogloeaceae bacteirum Par-f-2
Pathway
zpa00620  Pyruvate metabolism
zpa00680  Methane metabolism
zpa01100  Metabolic pathways
zpa01120  Microbial metabolism in diverse environments
zpa01200  Carbon metabolism
Module
zpa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:zpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C3497_11950
  09102 Energy metabolism
   00680 Methane metabolism
    C3497_11950
Enzymes [BR:zpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C3497_11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AVZ80063
LinkDB All DBs
Position
2511526..2514279
Genome map
AA seq 917 aa AA seqDB search
MAENTPPTDKDAPLREDIRLLGRLLGDTVRDQLGEASFALIERIRQTSVRFRRYEDLEAR
RELEGILDALAREQTIQVVRAFSYFSHLANIAEDQHHIRRSRAHLLAGSAPREGSLAHAL
DKTSRLLGEAATEALTRFFSQALVCPVLTAHPTEVQRKSILNCQTVIARLLDERDRMRLT
PEEAAANDAALRRAVLTLWQTRMLRPVRLSVIDEVNNGLSYFETTFLRELPRLYASVEDR
LGASSGELPAFLQVGSWIGGDRDGNPFVTAEVLERALALQAAAVLGFYLEELHALGSQLS
LAAGLVEVSDALQALADRSVDHSPHRRDEPYRRAIAGMHARLAATWNAWLGSSPPSPPVA
PAAPYLRPAELAEDLNTIDRSLVANGSAALAGGRLRHLRCAVKVFGFHLAPIDLRQNADV
HERVIAELLATAGGVADYRALDEAARVALLLRELASPRPLASPHLRYSDETESELAIFRA
ARAAHLRFGPAVIQNCIISKTDAVSDVLELAVLLKEAGLLRPHENALDVNIVPLFETIED
LRNAPGVMDRLFTLEPYRALLASRGFLQEVMLGYSDSNKDGGFLTSGWELYKAEIGLAEV
FARHRVRMRLFHGRGGSVGRGGGPSYQAILAQPGGAVQGQIRLTEQGEVIAAKYGNPEVG
RRNLEVLVAATLEASLLSGEALAPDPAFLDTMQTLSDSAFSAYRGLVYQTPGFEDYFWQS
TVISEIAELNIGSRPASRKKGRRIEDLRAIPWVFSWSQCRLMLPGWYGFGSAVKAWLATH
PQEGLAHLQRMYREWSFFATLLSNMDMVLAKTDLAIAARYAELVHDSTLRETIFQRICRE
WQDTVDALLAITGQQELLDGNPLLKRSIRNRFPYLDPLNHVQVELLRRHREQPGDDRLRA
GLHISINGIAAGLRNSG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaacaccccacccaccgacaaggatgcgccgctgcgcgaagatatccgcctt
ttgggccgccttttgggcgacaccgtgcgcgaccaattgggcgaagccagctttgcgctg
atcgagcgcatccgccagacctcggtgcgctttcgccgttacgaggatctggaggcccgt
cgcgagttggaaggcatcctggacgccctggcgcgcgaacagaccatccaggtggtgcgg
gccttcagctacttttcgcatctggccaacatcgccgaagaccagcatcacatccgccgc
tcacgcgcccacttgctcgccggctccgccccgcgcgaaggcagcctggcccacgcgctg
gataaaacctcgcggctgctgggcgaagcggccaccgaagcactcacccgctttttcagc
caagccctggtctgcccggtgctgaccgcccacccgaccgaagtacagcgaaagagcatc
ctcaactgtcaaacggtgatcgcccgcttgctcgacgaacgcgaccgcatgcgcttgacc
cccgaggaagcggccgccaacgacgccgcactgcgccgcgcggtgctcaccctgtggcag
acccgcatgctgcgcccggtgcggctgtcggtgatcgacgaagtcaacaacggtctgtcc
tacttcgagaccacttttttgcgcgagctaccgcgtctatacgccagcgtagaagaccgc
ctgggtgcctccagcggcgaactgccggctttcttgcaagtcggcagttggatcggcggc
gaccgcgatggcaaccccttcgtcaccgctgaggtgctcgaacgtgcgctcgccctgcag
gctgccgccgtactcggcttttacctggaggagcttcatgcgctgggctcccagctctcg
ctcgcggcgggcttggtcgaagtctccgatgcgctgcaggcgctggccgaccgttcggtg
gaccactccccgcatcgccgcgatgaaccgtatcggcgcgcaatcgccggcatgcatgcc
cgcctggcagccacctggaacgcttggctgggcagctcaccgcctagcccaccggtggcc
ccggccgcgccctaccttcgccccgccgagctggccgaggatctcaacaccatcgaccgc
tcgctggtagccaacggctcggccgcgctcgccggcgggcggctgcgccacttacgctgc
gcggtcaaagtgtttggctttcatctggcgcccatcgacctgcggcaaaacgccgacgtg
catgaacgtgtgatcgctgaactgcttgccaccgcaggcggcgtagccgattaccgggcg
ttggacgaagccgcgcgggttgcgcttttgctccgcgaactcgccagcccccgccctttg
gcctcgccgcacctgcgctatagcgacgaaaccgagtccgaactggccatcttccgcgcc
gcgcgcgccgcccacctgcgctttggccccgccgtcatccagaactgcatcatctccaaa
accgatgcggtctccgatgtccttgaactggccgtgctgctcaaagaggcgggtttgtta
cgaccgcatgagaacgcgctggatgtcaatatcgtgccgctgttcgagaccatcgaagac
ctgcgcaacgcgccgggcgtgatggatcgcctgttcaccctcgaaccctaccgcgcgctg
ctggcctcacgcggtttcctgcaagaagtcatgctgggctattcggacagcaacaaggac
ggcggctttttgacctcgggctgggagctttacaaagccgaaatcggcttggccgaagtc
tttgcccgccaccgggtgcgcatgcgcctgtttcacggccgcggcggatcggtggggcgc
ggcggggggccgagctaccaggccatcctcgcacaaccaggcggggcggtgcagggccag
atccggctgaccgaacagggcgaagtcatcgccgccaagtacggcaacccggaagtgggt
cgccgcaaccttgaggtgctggtagccgccaccctggaggccagcctgctctccggcgaa
gcgctcgcgccggatccggcctttctggacaccatgcagacgctctccgacagcgctttt
tccgcctaccgcggcctggtgtaccagacccccggtttcgaggactacttttggcaatcc
acggtgatcagcgagattgccgaactcaacatcggctcacgcccggcctcgcgcaagaag
ggcagacgcatcgaagacctgcgtgccattccctgggtgttttcgtggtcccaatgccgg
ctgatgctgcccggctggtacggctttggcagcgcggtcaaagcctggctggccacccac
ccgcaagaggggcttgcccacctgcaacgcatgtaccgggagtggtctttctttgccacc
ttgttgtcgaacatggatatggtgctcgccaagaccgacctcgccattgccgcccgctac
gccgaactggtgcatgacagcacactgcgcgagacgatcttccaacggatctgccgtgaa
tggcaggacacggtcgatgccttactggccattaccggccagcaggaactgctcgatggc
aacccgctattgaagcgctcgatccgcaaccgcttcccctatctcgacccactgaaccat
gtccaggtcgaactgctgcgccgccaccgcgaacaacccggcgacgaccgcctgcgcgca
gggctacacatctcgatcaacggcattgccgccggcttgcgcaacagcggctga

DBGET integrated database retrieval system