KEGG   Zymobacter palmae: ZBT109_0509Help
Entry
ZBT109_0509       CDS       T05646                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
zpl  Zymobacter palmae
Pathway
zpl00250  Alanine, aspartate and glutamate metabolism
zpl00410  beta-Alanine metabolism
zpl00430  Taurine and hypotaurine metabolism
zpl00650  Butanoate metabolism
zpl01100  Metabolic pathways
zpl01110  Biosynthesis of secondary metabolites
zpl01120  Microbial metabolism in diverse environments
zpl02024  Quorum sensing
Module
zpl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ZBT109_0509
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ZBT109_0509
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ZBT109_0509
   00430 Taurine and hypotaurine metabolism
    ZBT109_0509
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ZBT109_0509
Enzymes [BR:zpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ZBT109_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Trimer_CC
Motif
Other DBs
NCBI-ProteinID: BBG29297
UniProt: A0A348HCE5
LinkDB All DBs
Position
538749..540146
Genome map
AA seq 465 aa AA seqDB search
MPLHYRQDVRDALLDDVYASDDLSASLPRYRFPASELGARNAFNVVRDELMLDGNSRQNL
ATFCTTWLEDEVHQLMDACIDKNMIDKDEYPQTAELEARCVHMLADLWNSPDANNTMGCS
TTGSSEAAMLGGLALKWQWRKRREAEGKSTDRPNLICGPVQICWHKFARYFDVELREIPM
DGDRLIMNAEEVLKRVDENTIGVVVTFGVTFTCQYEPVQQIQKALDRLEEETGLDIPIHV
DAASGGFLAPFCAPDIPWDFRLPRVKSINASGHKYGLSPLGVGWVVWRDADELPEDLVFN
VNYLGGDMPTFALNFSRPGGQIVAQYYNFIRLGVEGYRRIQTACYNTAQYLADAIGKLGP
FEIIFGGDMTEGLPALCWKLKDDANVSFTLYDLADRLRTRGWQVPAYSMPADRTDLVIQR
ILVRHGVSRDLASLLVDDIQRCLDYFAQHPAAVPLSEEEGSGFHH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcattaccgacaggatgtccgcgatgcacttctggacgacgtctatgcgtcc
gatgacctatccgcttcacttccgcgctaccgtttcccagccagcgaactgggcgctcgc
aatgcgttcaatgtcgtgcgtgatgaactgatgctcgatggtaactctcgccagaatttg
gcgaccttctgtacgacttggcttgaagatgaagtccatcagttgatggatgcctgtatc
gacaagaacatgatcgacaaggatgaatatccgcagacagccgaattggaagcgcgctgt
gtgcacatgctggctgacctgtggaactcgccggatgccaacaatacgatgggttgttcc
acgaccgggtcgtcggaagccgccatgctgggagggctggcactcaaatggcagtggcgc
aaacgccgcgaagccgaaggtaaatcaacggatcgtcccaacctgatctgtggccccgtg
cagatctgctggcacaagtttgcccgttatttcgacgttgaactgcgtgaaattccgatg
gacggcgatcgcttgatcatgaacgccgaagaagtgctgaaacgcgtcgatgaaaatact
attggggtggtcgtgaccttcggggtgaccttcacctgccagtacgagccggtgcagcag
atccaaaaggcactagatcgcttggaagaggaaaccggtctggacatcccgattcacgtg
gatgctgctagcggtggttttctggcgccgttctgtgcgcctgacattccgtgggatttc
cgcctgccgcgcgtgaaatccatcaatgcctctggtcacaaatacgggctgtcaccgctg
ggcgtgggctgggtcgtatggcgcgatgccgatgaattgccggaagacttggttttcaac
gttaactatctgggcggtgatatgcccacctttgcacttaacttctcgcgcccggggggc
cagatcgttgcgcagtactacaacttcatccgcctcggtgtagaagggtatcgccgcatt
cagacggcctgctataacacagcgcagtatctggccgatgctatcggcaagttggggccg
ttcgagatcatcttcggcggtgatatgaccgaagggttgccagcactgtgttggaagctc
aaggacgatgctaacgtatcctttacactgtatgacctagcggatcgtctgcgtacgcgt
ggctggcaggtgccggcctactccatgccagcagatcgtaccgacttggttattcagcgc
attctggtgcgccatggggtcagccgcgatctggcttcgctgctggtcgatgacatccag
cgctgccttgattactttgcacaacacccggcggcagtgccgctttccgaagaagagggc
agtggttttcatcattga

DBGET integrated database retrieval system