KEGG   Zymobacter palmae: ZBT109_0897Help
Entry
ZBT109_0897       CDS       T05646                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
zpl  Zymobacter palmae
Pathway
zpl00550  Peptidoglycan biosynthesis
zpl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZBT109_0897
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ZBT109_0897
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zpl01011]
    ZBT109_0897
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zpl03036]
    ZBT109_0897
Enzymes [BR:zpl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ZBT109_0897
Peptidoglycan biosynthesis and degradation proteins [BR:zpl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ZBT109_0897
Chromosome and associated proteins [BR:zpl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    ZBT109_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: BBG29670
UniProt: A0A348HDG8
LinkDB All DBs
Position
967880..969709
Genome map
AA seq 609 aa AA seqDB search
MTQRRYSSFSSRQSSSSKRNPLGPSASWRMVLVRMILILGLCALIGRIVWLQVLDHDFLQ
GQGDARTVRTEIISANRGVIMDREGEPLAVSTPVITLIGNPREMSMERQDLVALAKALEE
PSIEAFVNRMVDQHNRNRSFVYLARRITADKAQQVQALKLPGIESRNEYKRYYPAGEVTS
QLVGITDINDEGSEGMERAYNELLRGVPGERKVLKDRRGNWVRDMPLFFKEASPGRNIQL
SISLRLQYLAYRELLNTVQAHNADAGSILIMNARTGEVLAEASVPSYNPNNISGGVERNR
PITDAMEPGSVMKPLAMATILESGKFSPDMTLDTSPGYMRLDNFTIRDVRNFGKLTLTGV
ITKSSNIGMTQLALALPNDVLWQAYRRMRLNQAPGTAFPGESAGSLPIPAVWSKSTRATL
AYGYGLAVSQLQLASAYTTIANDGRYLKPSLLKLPEAPQGEQLIQPQTAHQVLAMMETVV
GPYGGAGGAAIEGYRVAGKSGTPRKLSAQGKYEANSHRANFVGIVPATNPRLIMVITIDD
SKQGGYYGGAVAAPLFARVAGPALRMLDVPPDDKRDDGENSRHADDAVKVTGIRQPGAAE
AAARSTPND
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgactcagcgccgctattcctccttttcctctcgtcagtcctcttcttccaagcgtaat
ccgcttggcccgagcgccagctggcgcatggtgctggtgcgcatgatcctgattttggga
ctgtgtgcgctgatcgggcgtatcgtctggttgcaggtgcttgatcacgacttcctgcag
ggacaaggggatgcgcgtaccgtgcgcaccgagattatcagcgccaaccgcggggtcatt
atggaccgcgagggcgagccgctggctgtttccactcctgtcatcacgctgatcggtaac
cctcgtgaaatgtcgatggagcgccaagacttggtcgcactggccaaagcgcttgaagag
ccgtcaatcgaggccttcgtcaaccggatggtggatcagcacaaccgcaatcgctcgttt
gtctatctggcgcgtcgcatcacggccgataaggctcagcaggtacaggcgctgaaattg
ccgggcatcgaatcgcgcaatgaatacaaacgctactacccggccggggaagtgacgtcg
cagctggtgggcatcaccgatattaatgatgaaggcagcgaaggcatggagcgtgcctac
aacgaactgctgcgcggtgtgcccggcgagcgcaaggtactcaaggatcgtcgcggcaac
tgggtgcgcgatatgccgctgttcttcaaagaagccagtccggggcgcaatatccagctg
tcgatcagtctgcgtttgcagtatttggcgtaccgtgaattgctgaacacggtgcaggct
cacaatgccgatgccggttccatcctgattatgaatgcgcgcacgggtgaggtgctggcc
gaggccagcgtgccgtcctataaccccaataacatcagtggtggggtcgagcgtaaccgc
ccgatcaccgatgcgatggaaccggggtcggtcatgaagcccttggcgatggcgaccatt
ctggagtcgggcaagttctctccagacatgacgctcgatacttcgccgggttacatgcgt
ctggacaacttcaccatccgtgatgtgcgcaacttcggcaagctgaccctgactggggtc
attactaagtcttccaacattgggatgactcaactggcgctggcgttgcctaacgatgtg
ctgtggcaggcctatcgtcgcatgcgcctcaatcaggcgcccggcacggcattcccgggt
gaaagcgccggttcgctgccgattcctgctgtgtggtcgaaatccactcgcgccacgttg
gcttatgggtacggtttagccgtttctcagctgcaactggccagtgcctacacgacgatc
gccaacgacggccgctatctgaaaccctcgctgctgaagctgcccgaagcaccgcagggc
gagcagttgatccagccgcagacggcccaccaagtgctggcgatgatggaaaccgtcgtc
gggccatatggcggtgccggtggcgctgccatcgaaggctaccgtgttgccggtaaaagc
ggtacaccacgcaagctcagtgcacagggcaagtatgaggccaactcccaccgtgccaat
tttgttggcatcgtgccggccactaacccgcgcctgattatggtcatcaccatcgacgac
tccaagcaggggggctactacggtggggccgtggccgcgccgttgtttgcccgtgtggct
gggcctgcactgcgtatgctggatgtgccgcctgacgacaagcgcgatgacggtgaaaac
agccgccatgccgatgatgccgtcaaggtgaccggtatccgtcaaccgggtgccgccgag
gccgctgcgcgttcgacccctaatgactga

DBGET integrated database retrieval system