KEGG   Zymobacter palmae: ZBT109_2060Help
Entry
ZBT109_2060       CDS       T05646                                 

Definition
(GenBank) predicted membrane protein
  KO
K07058  membrane protein
Organism
zpl  Zymobacter palmae
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ZBT109_2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BBG30806
UniProt: A0A348HGQ4
LinkDB All DBs
Position
2270105..2271091
Genome map
AA seq 328 aa AA seqDB search
MDSDMQTSPSPKTSRDRRATSPLSVTRHGWWSILWRVYGSIQKHHIGMMASSIAFYGLLS
LFPAIAALISIWGMYADPVQVQQQLVNLDQFIPTEAASIIEHQAEVVTASAGRGLNLTAI
GSLLFTLYSASKSVQSFTEGLNIIYGEKEQRHFLAQIVINIVLTLGMILLAIFMLFSVAI
LPVVMNFFPFADTLTTSLYYLRWLIMLCIITLGIAVLYRFGPNRRAPRWEWLSIGTITST
LLWILGSLGFSLYVSHFGSYNSTYGSIGAVVVLLMWFWLSAYIILLGASINCELERTTEK
DTTTGTPKPMGQRHAYAADTVAKDSNDI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgatatgcagacgtctccttcccccaagacctcgcgggaccgccgcgcaacg
tccccacttagcgtgactcgccatggttggtggagcattctatggcgcgtatacggctca
atccaaaaacaccatatcggcatgatggcctccagcattgccttctatggactgctcagc
ctctttcccgccattgctgccctgatttcgatctggggcatgtatgccgaccctgttcag
gtacagcagcagctggtcaacctcgaccagttcattcctaccgaagcggcttccatcatt
gagcatcaggccgaagtggtcaccgccagtgctggccgtggattgaatctgaccgcgata
ggcagcctgttgttcaccctctacagtgcttctaaaagtgtgcagagcttcaccgaaggg
ctgaacatcatctatggtgaaaaggaacagcgacatttcctagcacagatcgtgatcaat
attgtattgacgctgggtatgatcctgctggccatcttcatgttattcagcgttgctatt
cttcctgtggtcatgaacttctttccattcgctgacacactaacgacatcactctactat
ctgcgctggctgatcatgctctgcatcatcaccctaggcatcgccgtgctatatcgcttc
ggacccaaccgccgcgccccgcgctgggaatggctcagcattggcaccatcacctcgaca
ctgctgtggatactggggtcactcggattctccctgtatgtcagccatttcggcagctac
aacagtacctacgggtcaatcggcgccgtcgtcgtcctactgatgtggttctggctatcg
gcttatatcatcctgctaggcgctagcatcaactgcgagcttgaacgcacgaccgaaaag
gacaccaccacgggcacaccgaaacccatggggcagcgccacgcctatgccgcagatact
gtagctaaagacagtaacgatatctga

DBGET integrated database retrieval system