KEGG   Zymobacter palmae: ZBT109_2149Help
Entry
ZBT109_2149       CDS       T05646                                 

Definition
(GenBank) asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
zpl  Zymobacter palmae
Pathway
zpl00970  Aminoacyl-tRNA biosynthesis
zpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ZBT109_2149
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:zpl03029]
    ZBT109_2149
Enzymes [BR:zpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ZBT109_2149
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ZBT109_2149
Mitochondrial biogenesis [BR:zpl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ZBT109_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BBG30886
UniProt: A0A348HGY4
LinkDB All DBs
Position
2361681..2363129
Genome map
AA seq 482 aa AA seqDB search
MLDMTLAEMARGLASGELKSSELTKALLDRIEQHDEKINSFITVTRDEALEAAEAADAAR
ARGDAGALTGAPIALKDIFCTKDVLTTCASHMLDNFVSPYDATVVERLKAAGTVSLGKTN
MDEFAMGSSNENSFFGPVHNPWNLDHVPGGSSGGSAAAIAAGFVPAAMGTDTGGSIRQPA
SFCGITGLKPTYGRVSRYGIIAYASSLDQAGPMAHTAEDCALLMNVIAGHDQRDSTCVNQ
DVPDYTAELDKPLKGLRIGLPVEYFGEGLDAGVEKVVREAIRTYEALGATVVEVSLPHTR
LAIPTYYVIAPAEASSNLSRYDGVRFGHRCDDPKDLIDMYLRSRAEGFGEEVKRRILMGT
HTLSEGFYDAYYRKAQRVRRLIRQDFIDAFEKVDVLMGPAAPTPAFGIGQQSDPIQMYLG
DIYTIAINLAGIPGISVPVGFTDGLPVGLQILGPHFGESRLLNTAHVFQQNTDWHTRRPT
LD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgctagacatgacccttgccgagatggcccgcggccttgcctcgggcgaactcaagagc
agcgagctgaccaaagcgctgctggatcgcatcgaacagcacgatgaaaagatcaacagc
ttcatcaccgtcacgcgtgacgaagcgctcgaagccgccgaagcggccgacgccgctcgt
gcgcgcggtgacgcaggcgcactgaccggtgctccgatcgccctgaaagacatcttctgc
accaaggacgtcctcaccacttgtgcctcgcacatgctggataattttgtctctccttat
gacgcaaccgtggtcgagcgcctgaaggctgccggcaccgtcagcctcggaaagaccaat
atggacgagttcgcgatgggctcttccaatgaaaacagtttcttcgggccggtacacaac
ccgtggaacctcgatcatgtaccgggcggctcctcgggcggttccgctgcggccatcgca
gcaggcttcgttcctgcggccatgggtaccgataccggcggttccattcgccagccagcg
tccttctgcggtatcactggtctaaaaccgacttacggtcgcgtctctcgctacggcatc
atcgcttatgcctccagccttgatcaggccggtccgatggcacacaccgccgaagactgc
gcactgctgatgaacgtcattgccggccacgaccagcgcgactccacctgcgtaaatcaa
gatgttcctgactacaccgcagagttggacaagccgctgaaaggcctgcgcatcggcctg
cccgtcgaatactttggcgaaggtctggatgccggcgttgagaaggttgttcgtgaagcc
attcgtacctacgaagcactgggcgcaaccgtcgtcgaagtgagcctgccgcatacgcgt
ctggccattccgacttattacgtcattgcaccggcggaagcctcttccaacctgtcccgc
tatgacggtgtccgttttggccatcgctgcgacgacccgaaagacctcatcgacatgtac
ttgcgctcacgcgcggaagggttcggtgaagaggtcaagcgccgcatcctgatgggcacg
cacacgctgtctgaaggcttctatgacgcctactaccgcaaggcacagcgcgtacgccgc
ctgattcgccaggacttcatcgacgccttcgagaaagtcgacgtcctgatgggccccgcc
gccccgacccccgcctttggtatcggtcagcagagcgacccgatccagatgtacttgggc
gacatctacaccattgccatcaacttggcgggtatcccgggtatcagcgttccggtcggc
ttcaccgacggactgccggtaggccttcaaattctcggcccgcacttcggtgaatcacgc
ctgctgaatacggctcacgtcttccagcagaacaccgactggcacacacgtcgtccgacg
ctcgactga

DBGET integrated database retrieval system