KEGG   Zymobacter palmae: ZBT109_2262Help
Entry
ZBT109_2262       CDS       T05646                                 

Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
zpl  Zymobacter palmae
Brite
KEGG Orthology (KO) [BR:zpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ZBT109_2262
Enzymes [BR:zpl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ZBT109_2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: BBG30994
UniProt: A0A348HH92
LinkDB All DBs
Position
2510372..2511934
Genome map
AA seq 520 aa AA seqDB search
MLDNALKTQLKAYLDKLTQPIALVASLDDRDASQQMKGLIEDLDSLSDKISVSFDGQSSR
RPSFTVGKAGEPARIEFAGIPTGHEFTSLVLALLHTGGHPPKTDPAVLDQIRQLDGEFMF
ETYISLSCQNCPDVVQALNLMATFNPNVRHTMIDGALFQDEVEARQVMSVPTTYLNGEQF
GQGRATLSEILNKVDTGAAKRQAAALNEKDTYDVLVVGGGPAGAAAAVYSARKGIRTGVV
AERFGGQVQDTMAIENFISIKETEGPKLAAALEEHVKSYDVDVMDTQRAARLVPAKDGQP
FAVELESGATLTAKSVIISTGARWRQVGVPGEDEYRNRGVAYCPHCDGPLFKGKHVAVIG
GGNSGVEAAIDLAGIVGKVTLFEFADTLRADAVLQRKLHSLPNVTVITEAQTTEITGDGQ
KVNGLSYTERATGESKHVALEGVFVQIGLVPNSGWLKDTLELTPQGEIVIDNRGQTSIPG
VFAAGDVTTVPYKQIVIALGEGAKASLASFDYLIRQGSED
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaatgcgctcaagacacagctcaaggcttacctcgacaagctgacgcaaccc
atcgcactagtcgcatctctggatgaccgcgatgcatcccagcagatgaagggactgatc
gaggatctggacagcctgtccgacaagatcagcgtttccttcgacggtcagtcctctcgc
cgcccgtccttcacagtaggcaaagcaggcgagccggcacgcattgagtttgcgggcatc
ccgaccggccacgagttcacctcgctggtactggcgttgctgcacacgggtggccatccg
ccgaaaaccgacccggcagtgcttgatcagattcgccagctggacggcgagttcatgttt
gagacctatatttcgctgtcatgccagaactgcccagacgtcgtacaggccttgaacctg
atggccacgttcaacccgaacgtccgccacaccatgatcgacggcgcgctgttccaagac
gaagtcgaagcacgccaggtcatgtccgtaccgaccacttacctcaacggtgagcagttc
ggtcagggccgcgcgacgctgagcgagattctcaacaaggtcgacactggcgcagccaag
cgacaggcagcggcactgaatgaaaaggatacctacgacgtgctggtagtgggcggtggc
ccggctggcgcggcagcggcggtctactctgcgcgcaaaggcatccgcactggcgtagtc
gccgagcgcttcggtggtcaggtgcaagacaccatggcgatcgaaaacttcatctccatc
aaggagaccgaaggcccgaaactcgcggctgcgcttgaagagcacgtcaaaagctacgat
gtcgacgttatggatacccagcgcgcagcgcgcctggtaccggccaaggacggtcaaccg
tttgccgtcgagctggagagcggcgctacgctgaccgcgaaatccgtcattatctcgaca
ggggcacgctggcgtcaggtaggcgtcccgggtgaagacgagtaccgcaaccgcggcgta
gcgtactgcccgcactgcgacggcccgctgttcaaaggcaagcacgttgcggtcatcggt
ggcggtaactctggcgttgaagcggctatcgaccttgccggtatcgtgggcaaagtcaca
ctgttcgaatttgccgatactctgcgcgccgacgcggtactgcagcgcaaactgcacagc
ctgccgaacgtcacggttatcactgaagcacagaccaccgagatcaccggtgacggacag
aaggtcaacggcctgagttacaccgaacgcgcaacgggcgagtctaaacatgttgcactg
gaaggcgtcttcgttcagatcggcctggtacccaacagcggctggttaaaagacacactg
gaactgacaccgcagggcgagatcgtaatcgacaaccgcggccagacctccattccaggc
gtgtttgcagcgggcgacgtcacgaccgtgccgtacaaacagatcgtgattgcgctgggt
gaaggcgcgaaggcatcactggcctcgtttgattatctgattcgtcagggtagtgaagat
tga

DBGET integrated database retrieval system