KEGG   Zunongwangia profunda: ZPR_0766Help
Entry
ZPR_0766          CDS       T01216                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00564  Glycerophospholipid metabolism
zpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ZPR_0766
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ZPR_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Pyr_redox_2 Thi4 Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADF51116
UniProt: D5BGF7
LinkDB All DBs
Position
834100..835674
Genome map
AA seq 524 aa AA seqDB search
MAAKNIYSRKSLVDSVKSVEKWDVIVIGGGATGLGVALDSVTRGYKTLLLEQVDFAKGTS
SRSTKLVHGGVRYLAQGNIDLVKEALYERGLLSKNAPHLVKNQSFVIPNYRWYEGIYYTI
GLKAYDFLAGKLSLGKSTHINKGETLKRVKTIRQDKLRGGVVYQDGQFDDSRLAVNVAQT
CVEHGASVLNYFKVNNLIIEDKAIKGVSAKDMETGEDYQFFGDAIINATGVFTDDILKME
NPNARNMVKPSQGVHLVFDKSFLPGEDAIMIPKTEDGRVLFAVPWHDKVIVGTTDTQLDE
HSLEPSALEKEIEFILETFNNYLEKKVTRADVRSIYAGLRPLAAPKDGSEKSKEISRSHK
ILVSETGLITITGGKWTTFRRMAQDTVNKAISLGKLPKKECKTADLKIHGAKENPDLSNH
LYIYGSDQPEIQNLINEDSSLGEKLHPRLDFLKAEVVFAARHELARTVDDVLARRVRMLF
MDAKAAIESAPEVAALLAKELEKDEAWKEKQVADFKEIAKHYTI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaaaaatatatactcaagaaaatctctagtcgattcagtaaaatctgttgaa
aaatgggatgttattgtaattggaggtggagcaacaggtttaggtgttgctttagatagt
gttaccagaggttataaaacattattactggagcaggtagattttgcaaagggaacttcc
agtcgtagtacaaaactggtacatggaggggtaagatatttagcgcagggaaatatagat
cttgttaaagaagctttatatgaacgcggtctgcttagtaaaaatgcaccacacttagtc
aaaaaccaaagctttgttattcctaattacaggtggtacgaaggtatttattacactata
gggcttaaagcttatgattttcttgctggtaaacttagtttagggaaatctacccatatt
aataaaggagaaactttaaaaagagtgaaaaccattcgccaggataaattaagaggcgga
gtggtctatcaggatggacagtttgatgattcacgtttggctgtaaatgttgctcaaact
tgtgttgagcacggtgcatctgttctaaattattttaaagtaaacaaccttataatcgaa
gataaggcaattaagggagtatctgccaaggatatggagactggtgaggattatcaattt
tttggtgatgctataattaatgcaaccggtgtattcacagatgatatcctaaaaatggaa
aatcccaatgcccgcaacatggttaaacctagccagggtgtacaccttgttttcgataaa
tcttttctgccgggcgaagatgctattatgattccaaaaaccgaagatggtcgtgtgctt
tttgcagtgccgtggcatgataaagtgattgtaggaacgacagatacgcagttagacgaa
catagtctggaaccttcagcactagaaaaggaaatagaatttattttagaaaccttcaat
aattatctagagaaaaaagtaactagggctgatgttcgcagtatatacgccggtttaaga
ccgttagcagcaccaaaagatggttcagaaaaatcaaaagagatttcaagaagtcataaa
atactagtgtcagaaacaggtttgattacaattacaggtggaaaatggaccacttttaga
agaatggctcaggacaccgtaaataaagccatttcacttggtaaactaccaaagaaagaa
tgtaaaactgcagatcttaaaatacatggtgctaaagaaaaccccgatctttcaaatcac
ttgtatatttacggaagtgaccagccagaaattcaaaatttaattaatgaggattcttcc
ctcggagaaaaacttcaccccaggttagattttctaaaagcggaagtcgtatttgcagca
aggcacgagttagccagaacagtagacgatgtgttggcgagaagagtaagaatgttgttt
atggacgctaaagccgcaatagaatctgctccagaagttgctgctttattagcaaaagag
cttgaaaaggatgaagcatggaaagagaaacaagtagccgattttaaagagatagccaag
cattacaccatttaa

DBGET integrated database retrieval system