KEGG   Zunongwangia profunda: ZPR_2491Help
Entry
ZPR_2491          CDS       T01216                                 

Definition
(GenBank) glycoside hydrolase family protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00052  Galactose metabolism
zpr00511  Other glycan degradation
zpr00600  Sphingolipid metabolism
zpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ZPR_2491
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    ZPR_2491
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ZPR_2491
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ZPR_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 BetaGal_dom4_5 AARP2CN
Motif
Other DBs
NCBI-ProteinID: ADF52815
UniProt: D5BE56
LinkDB All DBs
Position
2678396..2680897
Genome map
AA seq 833 aa AA seqDB search
MIAYKQYIINKLYLGTLAIVSFLLFACQKKEEDPEVFNRKQLFTEDWKFYKNDTLNSLTE
VLNSEDWRPIDVPHDWSIHQEFDKNSAAGIGGGALSGGVGYYKKSFNLPLEDSTRLYKIQ
FDGVYQNSEVWINGSYLGKRPNGYIGFEYDLTPYLHYGSQDNTIVVKADNSDQPNSRWYS
GSGIYRNVWLKKLNKIHIPNWGTFITTPSISKEKALVNITAKIKNEFLEDKEIEVQITIF
QDDQEIVKSETSALNITTNSEIGFNKELTIYKPKLWSIDSPWLYKAQIDIIQNKNLIDRF
ETRFGIRDFKFDFEKGFKLNGESLKIRGVCMHHDLGPLGAAINTRAIERQLEILKEMGVN
GIRTAHNPPAPELLDLCDQMGFIVMDEAFDIWTTAKTKHDYSQYWDKWHEQDIADLIKRD
RNHPSVFLWSIGNEIQEQWSEKGEKIGIELSNIVKSLDSKRPVTAGMNPPVHVSDKEVTI
QFEETADKPNSLAGSGALDVIGYNYAHQTWEKHQLNFPNTPFIATETTSGLQTRGYYEFP
SDTTKIWPVRWDKLFTGGNPDHTISAFDQVRAPWGSLHETSWKIIKKNDFLSGFFIWTGF
DYIGEPTPYEWPSRSSYFGIVDLAGFPKDVYYMYKSEWTDDDVLHLLPHWNWEQGQTVDV
WAYYNNADEVELFLNGESRGTRSKRDDELHVMWRFPFESGTLKAISRKNGQIVKETEIRT
ASKPAKLELFPDRKKIRADGLDLSFITVTITDAEGTIAPRANNQIDFEIEGPGEIVGVSS
GDPTNHESFKGKSHRALNGKCLVIVQSTRQAGEIKISANSAGLESNSAVLISH
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttataaacagtacattattaataagttatacctaggcaccctcgctatagtt
tcttttcttctttttgcctgccagaaaaaagaagaagatccagaagtttttaatcgcaaa
caattatttacagaggattggaaattctataaaaacgatacgcttaatagccttactgaa
gttttaaattctgaggattggcggcctatagacgtgcctcatgactggagtatacatcag
gaatttgataaaaatagcgcggcaggtattggcggaggagcgctttcgggtggtgtaggc
tattataaaaaatcatttaatcttcctttagaagatagtaccagattgtataaaattcaa
ttcgatggcgtgtatcaaaatagtgaggtttggataaatggcagttatttaggtaaacgt
cccaatggttatatagggtttgaatatgatctaaccccttatcttcattatggttcacaa
gataatacgatcgtagtcaaagcagataatagtgatcagcctaattccagatggtattca
ggaagcggaatttatcgaaatgtctggttaaaaaaactaaataaaattcatattccaaat
tggggtacgtttattacaacacctagcatttctaaagaaaaagcgctggtaaatattact
gctaaaattaaaaatgagtttttagaagataaagaaattgaagttcagataactattttt
caggatgatcaggaaatagttaagtccgaaacttcagctttaaatattaccactaattca
gaaattggttttaataaagagcttacaatctataagcctaagttatggtcaatagattct
ccttggttgtataaggcccaaatagatattattcagaataaaaatcttatagatcgtttc
gaaacaagatttggtattcgagattttaaatttgatttcgaaaaaggatttaaactgaat
ggggaatccctaaagattcgtggggtttgcatgcatcatgatcttggtcctttaggagca
gcgattaatacaagggcaatagaaagacaattagagatattgaaagaaatgggcgtaaac
ggaatccgtacagctcataaccctccggcaccagaattactggatttatgtgatcaaatg
ggattcatcgtaatggatgaagcctttgatatttggacgactgctaaaacaaaacacgat
tatagccaatattgggacaaatggcatgagcaggatatagcagatctgattaaaagagat
cgaaaccatcctagtgtctttctatggagtattggaaacgaaatacaggaacaatggagt
gagaaaggagaaaaaattggtatagaattatcgaatatcgtcaaaagtttagatagcaag
cggccggtaaccgccgggatgaatccgccagttcatgtttctgataaagaggtaactatt
caatttgaagaaactgcagacaagccaaattcgctggcaggatctggtgctttagatgtt
ataggctataactatgcgcatcaaacctgggaaaaacatcaactcaactttccaaataca
ccatttattgctacagaaactacttctggattacaaaccagaggttattatgagtttcca
tctgataccacaaagatctggccggtacgctgggataagctttttaccggtggtaatcca
gatcacacaatttcggcattcgatcaggttagagccccctggggatcattacacgaaacc
agttggaagatcattaaaaagaacgactttttatctggattttttatctggaccggcttt
gattatatcggcgaaccaacaccttatgaatggccttcccgtagttcatattttggaatt
gtagatctggcaggctttcctaaagacgtgtattacatgtacaaaagtgaatggacagat
gatgatgtccttcatttattacctcattggaattgggaacaaggacaaacggttgatgtt
tgggcgtattataataatgcagatgaggttgaattatttcttaatggagagagcagggga
accagatctaaaagagacgatgagcttcatgtgatgtggcgatttccttttgaatcagga
actttaaaagcaatttccagaaaaaacggccaaattgtaaaagagactgagattagaaca
gcatcaaaacctgctaaattagagttatttccagatcgaaagaaaatcagggcagatgga
ttagacctttcattcattaccgtgactattactgatgcagaaggaacaatagcgcccaga
gcaaacaaccaaattgatttcgaaatcgaaggacccggagaaattgttggcgtatccagc
ggtgatcctaccaatcatgaatctttcaaaggaaaatcacatcgcgcacttaatggaaaa
tgtttagtgattgttcaatcaacacggcaggctggagaaattaaaatttctgcaaattca
gcaggattagaaagtaatagcgcagtgttaatatcccattaa

DBGET integrated database retrieval system