KEGG   Zunongwangia profunda: ZPR_2718Help
Entry
ZPR_2718          CDS       T01216                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00620  Pyruvate metabolism
zpr00680  Methane metabolism
zpr01100  Metabolic pathways
zpr01120  Microbial metabolism in diverse environments
zpr01200  Carbon metabolism
Module
zpr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ZPR_2718
  09102 Energy metabolism
   00680 Methane metabolism
    ZPR_2718
Enzymes [BR:zpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ZPR_2718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF2121 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: ADF53040
UniProt: D5BFE2
LinkDB All DBs
Position
complement(2911505..2914087)
Genome map
AA seq 860 aa AA seqDB search
MHREPKLERFNENVLSKYQIYNSLFLTLPFNDIRKTGSLLPLFQEVCEKGFKENKNPSEI
VEAFFKKYLDDPSEKDMNDLLFRFIQYIERQVVLFDAIEDAAFPIVNNMDGIGTLRNIKE
ESESRNQNEKLREFLTRFKVRPTLTAHPTQFYPGAVLGIITDLDKAIQNDDLVKIKQLLS
QLGKTPFFKKEKPTPLDEAISLIWYFENVFYQSVSKIYSYIQQNMFDGDSIGNEIIELGF
WPGGDRDGNPFVTTDITLQVAKRLKSTILFCYYRDARKLKRRLTFEGVNETIEEIERALY
DGAVSESATIKLPLKELKVKLHAIREVLINKHQSLFLDEVDDLLNKVNLFGYHLATLDIR
QDSGVHEEVLSEIIAVCEKRGDNLIPKNYKELSDKEQIEILSNVTGNLSADEFDSEDGMG
KATISSIHAMKQIQKTNGEKGANRYIISHSEVPQSVLEPFAFLRLCGWDQPSVDIIPLFE
TVPDLKASPEVMKTLYSNPVYREHLERRGNKQTIMLGFSDGTKDGGYLMANWSIYKAKQE
LTEISREYDIKVTFFDGRGGPPARGGGKTHQFYASLGSAIENEEIQLTVQGQTISSNFGT
KDSCQYNLEQLISAGVSNEIFNHGKNNLSDEDRKTMVNLAETSYNTYMDFKAHPRFIPYL
EKMSTLKYYAKTNIGSRPSKRNNNALNLDNLRAIPFVGSWSQLKQNVPGFFGVGTALKKY
EENGEFDKVKQLYNNSIFFKTLLENSMMSLTKSFFELTAYMKEDEEFGEFWQIIHDEYIR
SKEMLLKVTGYKELMENEPAMRASIQARERIVLPLLTIQQHALRMVQKLQDSGDTERLDE
FEKMVTRSLYGNINASRNSA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgcatagagaacctaagttagaacgtttcaatgaaaatgttctttctaagtatcaaatt
tataacagtctttttctaaccctgccatttaatgacattcgtaaaaccggatctttatta
ccactttttcaggaagtttgcgaaaaaggatttaaagagaataaaaatccctctgaaatc
gtagaggcattttttaagaaatatctggatgatccttcagaaaaagatatgaatgatctt
ttgtttaggttcatacaatatatcgaaagacaggtagtattatttgacgccattgaagat
gctgcttttcctatcgttaacaatatggatggtattgggacacttcgaaatataaaagaa
gagtctgaatcccgaaatcagaatgaaaaactacgggagtttttaacccggtttaaggtt
agaccaactttaacggctcacccaacacaattttatcctggcgctgtattaggaatcatt
accgatcttgataaggccattcaaaacgatgatcttgtaaagataaaacaacttttatct
cagcttggtaagacaccgttctttaaaaaagaaaaaccaacgccacttgatgaggccata
agtcttatatggtattttgaaaatgtattttatcaaagtgtaagtaaaatatatagctat
atccagcaaaatatgtttgatggtgatagcattggcaatgaaattatagaattagggttc
tggcctggtggtgaccgtgatggaaatccttttgtaactacagatatcaccttacaggtg
gccaaaaggcttaaaagtactatattgttttgttactatcgtgatgccagaaaacttaaa
aggagattgacttttgaaggggtaaatgaaaccattgaagaaattgaaagagcactttat
gatggtgccgtttcggaaagcgctaccattaaattaccacttaaagaactaaaggttaag
ttacatgctatcagagaagtattgataaacaaacatcaatcgttattcctggatgaagta
gatgatcttttaaataaagttaatttatttggataccatctggctaccttagatatccgt
caggatagcggggttcatgaggaggtactttcagaaattattgccgtttgcgaaaaaaga
ggggataacctaatccctaaaaattataaagagctttcagataaagaacaaattgaaatt
ctctcaaatgtaaccggaaatctctctgcagacgagtttgatagtgaagatggaatgggg
aaagcaactatttcttccatccatgcgatgaaacaaatccagaaaactaatggagaaaaa
ggagccaaccgttatattattagtcatagtgaagtgccgcagagtgttttagagcctttt
gcatttttaagactttgtggatgggatcaaccaagtgtcgatataattccgttattcgaa
acggtaccagatttaaaagcttcaccagaggtaatgaaaactttatatagcaatcctgta
tatcgtgagcatttagagcgtagaggtaacaaacaaactataatgcttggttttagtgat
ggtactaaagatgggggataccttatggcgaactggagtatctataaagctaaacaggaa
cttaccgaaatatctagagaatatgacattaaagtcactttctttgatgggcgtggagga
ccaccagcacgtggaggcggtaaaacacaccaattctatgcttctctaggttcagctatc
gaaaatgaagaaatccagttaaccgtacagggacaaaccattagtagtaattttggaact
aaagatagttgccagtataacctggagcaattaataagtgcaggagtgtctaacgagatt
tttaatcatggtaaaaacaatttgtctgatgaagatcgtaaaacaatggtaaatctggcc
gagaccagctataatacctatatggactttaaagcgcacccaagatttattccttattta
gagaagatgagtacgcttaaatattatgccaaaacaaatattggtagccgaccatcaaag
agaaataataatgcattaaatcttgataatttacgtgcaattccttttgtaggtagctgg
agccagttaaaacaaaacgtacctggattctttggtgtaggtacagcattaaagaaatac
gaagaaaacggagaatttgataaagtaaaacaactgtataataattcgattttctttaaa
accttgcttgaaaatagtatgatgagtttaaccaaatcttttttcgaattgactgcctac
atgaaggaagatgaagaatttggtgaattctggcaaattattcacgatgagtatatacgt
tccaaagaaatgctattaaaagtgaccggttacaaagagcttatggaaaatgagcctgcg
atgagggcttcgattcaggccagggagcgtatcgttcttccattgcttactattcagcaa
catgcattaagaatggtacaaaagctccaggacagtggtgataccgaacgattggatgaa
ttcgaaaaaatggttaccagatccttatacggtaatattaatgcaagtagaaattcagct
taa

DBGET integrated database retrieval system