KEGG   Zunongwangia profunda: ZPR_2875
Entry
ZPR_2875          CDS       T01216                                 

Definition
(GenBank) putative alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00052  Galactose metabolism
zpr00500  Starch and sucrose metabolism
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ZPR_2875
   00500 Starch and sucrose metabolism
    ZPR_2875
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ZPR_2875
SSDB
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Other DBs
NCBI-ProteinID: ADF53195
UniProt: D5BGL4
LinkDB
Position
complement(3098155..3100113)
AA seq 652 aa
MYLSKFKAGLIWILLYSCFIYQSNAQQQYQLDSPDKDLKINIEISDSIYYSVYAQGELLL
GNNTLSLQLKNEVLGVKPKIKKVKNTSGTEERSPIVPLKFSNIKKDFKAIEIEFKGNYSI
EFKAYNEGIAYRFKLGKKGSLEVIQENFDIVFPAEYTLHLQQTPSFKTSYEYPYTHLKSS
DFTAEESMSVLPVLIETTGNHKILISESDLLNYPAMFVKGTGNGLKSVFPKNPIDFEDEG
DRSMKILKRADYVAKIDGNRTLPWRYFVISDKDTEILENTMSANLATPNVLKDVEWIKPG
QVSWEWWNGASPYNVDFVAGFNEETYKYFIDFASEFGIPYIIMDEGWAASTTDPYTPNPD
IDLFELIEYGKKRNVKIVLWLTWLTVEHHFDLFEKFAEWGIAGIKIDFMDRSDQWMVHFY
ERVAKEAAKHELFVDFHGSFKPAGLEYKYPNILSYEGVLGMEQMGRATPDNSLFLPFMRN
AVGAMDYTPGAMISMQPEFYYSRRPNSAAIGTRAQQMAFFVIFESGLQMLADNPTNYFKN
EECTQFITDVPVTWDQTIALEAEVGQYAIVAKRKGKQWYLGGIANSKEDERTFKIKLDFL
PEGETLQLTSFEDGVNAKRQAMDYVKRTKTVKKDDVLEITIVKNGGWAAKIE
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgtatttatctaaatttaaagctggtctaatctggatcttattgtactcgtgttttatt
tatcaaagtaacgcccaacagcagtatcagttagactctcctgataaggatttaaaaata
aacattgaaatttcggatagtatttactattcggtgtatgctcagggagagttgttgctc
ggcaataacaccttaagtttacagttgaaaaatgaagtgcttggggtaaaaccaaaaatt
aaaaaggttaaaaatacaagtggaacagaggaacgttcgcccatagtacctttaaaattt
tcaaatataaaaaaggactttaaagctattgaaatagagtttaaaggaaactattctata
gagtttaaagcatataatgaaggtattgcctataggtttaaattaggtaaaaaaggcagt
ttagaggtgattcaagaaaattttgatatcgtttttcctgcagaatataccttacacctg
caacaaacaccttcttttaaaacttcttacgaatacccttatacgcatttaaaaagctcg
gatttcactgctgaagaaagcatgtcggttcttcctgttttaatcgaaacgaccgggaat
cataaaatcttaatttcagaatcagatcttttaaattatccggcaatgtttgtaaaagga
acgggaaatgggttgaagtcggtatttccgaaaaatccaattgattttgaagatgaagga
gatcgaagtatgaagattttaaaaagagccgattatgtagctaaaatcgatggtaacaga
acgctgccgtggcgttatttcgtgattagcgataaagacacagagattttagaaaatacg
atgagtgctaacctggcaacacccaatgttttaaaagatgttgaatggattaagccgggc
caggtaagttgggaatggtggaatggagcctcaccctacaatgtagattttgttgctggc
tttaatgaagagacctacaaatattttatcgatttcgcatctgaatttggaattccttac
attattatggacgagggctgggcggcaagcactacagatccttatactccaaatccagat
atcgacctttttgaactaatagaatatgggaagaaacgcaatgtaaaaattgttttatgg
ttaacctggcttaccgtagaacaccattttgatttatttgaaaaatttgcagagtgggga
attgcaggtataaaaattgattttatggatcgtagtgaccagtggatggtacatttttac
gaacgtgttgctaaagaggcagctaaacatgaactttttgtagattttcatggctctttt
aagcctgctggattagaatacaaatatcctaatatattatcgtacgaaggcgttttggga
atggaacaaatgggacgagccacaccggataatagtttgtttttaccatttatgagaaat
gcagttggagctatggattataccccaggagcaatgataagcatgcaacccgaattttat
tacagcagaagaccaaattctgccgcaataggtacaagagctcaacaaatggcttttttt
gtgatttttgagagtggtttgcaaatgctagccgataatccaaccaattattttaaaaat
gaagagtgcacccaatttatcaccgatgtaccggttacctgggatcaaacaattgctctg
gaagctgaagtgggccaatatgctattgtagctaaaagaaaaggtaaacaatggtattta
ggtggcattgctaatagtaaagaagacgagcgtacgtttaaaattaagttagatttttta
ccagaaggggaaaccttgcaacttacttcttttgaagatggggtgaatgccaaaagacag
gccatggattatgtaaaaaggacaaaaacggttaaaaaggatgatgttttagaaattacc
atcgttaaaaatggtggctgggctgcaaaaatagaataa

DBGET integrated database retrieval system