KEGG   Zunongwangia profunda: ZPR_2878Help
Entry
ZPR_2878          CDS       T01216                                 

Definition
(GenBank) ATP/GTP-binding site motif A (P-loop):ABC transporter
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
zpr  Zunongwangia profunda
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zpr03400]
    ZPR_2878
DNA repair and recombination proteins [BR:zpr03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ZPR_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbcCD_C AAA_29 Tropomyosin_1 AAA_21 SMC_N ABC_tran T2SSE CbiK RNA_helicase NTPase_1 AAA_25 DUF87
Motif
Other DBs
NCBI-ProteinID: ADF53198
UniProt: D5BGL7
LinkDB All DBs
Position
3103679..3106699
Genome map
AA seq 1006 aa AA seqDB search
MKILKIEFENINSLRGPQQIDFTDKPFSASSLFAITGPTGSGKSTILDVICLALFNHVPR
LGKITKNEIIAKGAILTRNQKEAFARVTYDCKRGVYASKWSISTNRNDNLRDYEMEIADL
ASGKLIDLKKSDVPAKNEALIGLNYNQFIKAVLLAQGEFAQFLKVNKAERGELLEKITGT
GIYRELGKKAYEKNKEASKEILQQQQEIEIIQKSLLNDEDHAEISKDYASQQAACEPLEK
EIQRLSKFVELKEEIKNQQSNIAKIAAEKTQAEEYLNQFNENNGKSLTEHENLQEHAGDL
RNWKQGKENEAEISKEITEIEAKIGENKQAFSGLLSEVSQLLKTEVSANDFEGKLNEFTG
KIQQLEEERKEKGREYSKLMDELKLKTGDLSINFSKNPDENIQQLQAISNSAANRIENYE
AELSNFDSDAEALKLQLKEQTEKTRAAQKANSKIDESDRELKKIASEKTTIKKQSEALPQ
QIKDLDTKVQFQQKDLENLQLQQKNKLLEARLEDLRHNLIDNEPCPLCGAKHHPFADHAP
EKDNLLEEKITQLQKELQLNSSQLAKIQANFENFQQRLKTLEIEEQQWKATSEEKRIAFK
TQFKDFDLATDEVWESSIARLSEQLELIEKWEKEQKQWQIAKNAIPLLEQTKEIIKQGRD
IAGKLKALYDGDDIVEKNRLYHRSFTTLTQQKKSLQEQLENLKSRFQKLTSELLILEQQL
SVVLKEKGYESLQQALKNLLPEKEYSQLRQEREKLQEKLSQLSTSHNLLQQQLEEKQKLD
IEETSAELQDQLTQKRQKLNDINESSKALYRQLENQKENLNQLNNIRAGIAEKEQKIKRW
RLLNELIGDATGRKFNEFAQDLTLTQLIALANKRLADLSDRYVIDKPMDEEDDGLVAIDE
HMGGQRRSVKTLSGGETFILSLSMALALSDLASKNVEINSLFIDEGFGTLDPETLDQTLD
TLEKLQAESSKTIGIISHVDSLKERIATQVILSRNGQGYSSISIKG
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaaaaattgaattcgaaaatatcaattcgcttcgcggaccgcagcaaatc
gattttaccgataaacccttttctgccagttcgctttttgctattaccggccctaccgga
agtggaaaaagtacgattttagatgtgatttgcctggcgctttttaatcacgtaccacgt
ctggggaaaatcacgaaaaacgaaattattgccaaaggcgcgatccttacccgtaatcaa
aaagaagcttttgccagggtaacctacgattgcaagcgtggcgtgtatgcttctaaatgg
tctatttccactaatcgtaatgataatcttagagattatgaaatggaaattgcagattta
gcctctggtaaattaatcgatctaaaaaagtccgatgttccggcgaaaaacgaagccctg
atcggtttaaattataaccagtttatcaaagcagttttattggcccagggtgaatttgcg
cagtttttaaaggtaaataaagcagaacgaggcgaacttctagaaaaaatcaccggtacc
ggtatctatcgcgaacttgggaaaaaagcctatgaaaagaataaggaagccagtaaagaa
atcttacaacaacaacaggaaatcgaaatcatacaaaaatcattgctgaatgacgaagat
catgctgaaatttcaaaagactacgcttcacagcaagctgcctgcgaacctctggaaaaa
gagattcagcgattatcgaaatttgttgaattaaaagaagaaattaaaaatcagcagtcc
aatattgcgaagattgctgctgaaaaaacacaggctgaagaatacctgaatcagtttaac
gagaataacggtaagtcccttaccgaacacgaaaatttacaggaacacgccggcgattta
cgaaattggaaacaaggcaaagaaaacgaagcagaaatctctaaagaaattactgaaata
gaagccaagattggtgaaaataagcaggcattttcaggattattatctgaagtttcccaa
ttgttaaaaactgaggtttcagcaaacgattttgaaggaaagctgaatgaatttacaggt
aaaattcagcaattggaagaagaacgcaaggaaaaaggtcgtgaatacagcaaattgatg
gatgagcttaagctgaaaacaggcgatttatcgattaattttagtaaaaatccagatgag
aatattcagcaactacaggcaattagtaattcggctgcaaatcgtatcgaaaattatgaa
gctgaattatcgaattttgatagcgatgcagaagccttaaagcttcagcttaaagaacaa
actgaaaaaacacgagcggcacaaaaagcgaattcgaaaatcgatgaaagcgacagagaa
ttaaaaaaaatcgcttcagaaaaaacaactattaaaaagcaaagtgaagcactaccgcag
caaatcaaagacttagacaccaaagttcagtttcagcaaaaagacctcgaaaacttacag
ttacagcaaaaaaataagttactagaggcgagattagaagatttacgtcataatttaatt
gacaatgagccctgcccgctttgcggcgccaaacatcatccttttgcagatcatgcccca
gaaaaagataatcttttagaagaaaaaattacacaacttcaaaaagaattgcagttgaat
tcatcgcaattagctaaaattcaggcgaattttgaaaattttcagcagcgattaaaaaca
ctggagattgaggagcagcaatggaaagcaacttccgaagaaaaaagaatagcgtttaaa
acccaatttaaagattttgatcttgccacagatgaggtttgggaaagtagcattgccagg
ttaagtgagcaattagagctgattgaaaaatgggaaaaagagcaaaaacaatggcaaatt
gctaaaaatgcgattccgttactggaacaaaccaaagaaattataaaacagggtcgggac
attgcagggaagcttaaagctttatatgatggtgacgatattgtggaaaaaaatcgctta
tatcatcgcagttttaccactttaactcagcagaaaaagtcgttgcaggaacagctggaa
aatttaaaaagcaggtttcaaaaattaacttcagaattattgattttggaacagcagctt
agtgtggttttaaaagaaaaaggctacgaaagtttgcagcaggcacttaaaaatttgtta
ccagaaaaagagtattcgcaacttaggcaagaacgcgaaaaacttcaggaaaaattatcg
caattaagcacttcgcacaacttactgcaacaacaattagaagaaaaacaaaagctggat
atcgaagaaacctcagcagaattacaggatcagcttacccaaaaacgccagaaattaaac
gacataaatgaatccagtaaggcactctacaggcagttggaaaaccagaaagagaatcta
aatcaactcaataatattagagcaggaattgcagaaaaagagcaaaaaataaagcgttgg
cgattactaaatgaattaattggcgatgcgaccggcagaaaatttaacgaatttgcacag
gatcttaccttaacccaactcattgctttagccaataaacgactggccgatcttagtgat
cgctatgtaatcgacaaaccgatggacgaagaagatgacggattagtagcaatcgatgag
cacatgggagggcaacgacgatctgttaaaacactttctggcggagagacctttatctta
agtttatcgatggccctggctttatctgatcttgcatctaaaaatgtagaaatcaacagc
ctgtttatagacgagggctttggcactctggatcctgaaactttagatcagactctggac
actttagaaaaattacaggcagaatcgtcgaaaaccatcggtatcattagtcatgtggat
tctttaaaggagcgaatagcaacacaggtgatacttagcagaaacggacagggctatagc
agtataagcataaaaggctaa

DBGET integrated database retrieval system