KEGG   Zunongwangia profunda: ZPR_3242Help
Entry
ZPR_3242          CDS       T01216                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00061  Fatty acid biosynthesis
zpr00780  Biotin metabolism
zpr01100  Metabolic pathways
zpr01130  Biosynthesis of antibiotics
zpr01212  Fatty acid metabolism
Module
zpr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ZPR_3242
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ZPR_3242
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ZPR_3242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:zpr01004]
    ZPR_3242
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ZPR_3242
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ZPR_3242
Lipid biosynthesis proteins [BR:zpr01004]
 Fatty acid synthase
  Component type
   ZPR_3242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ADF53558
UniProt: D5BIE5
LinkDB All DBs
Position
complement(3528223..3529050)
Genome map
AA seq 275 aa AA seqDB search
MSYNLLKGKKGIIFGALDENSIAWKTAVKAHEEGAEIVLTNAPIAMRMGSIKTLAEQIGA
EIVPADATKVEDLENLVDKATEILGGKIDFVLHSIGMSVNVRKGKHYTDQNYDWTAKGWD
VSAVSFHKTMQALYQKDAMSEWGSIVALSYMAAQRVFPDYNDMADNKAYLESIARSFGYF
FGKEKKVRVNTISQSPTPTTAGQGVKGFDGFIAYADKMSPLGNATAQDCADYTITLFSDL
TKKVTLQNLYHDGGFSNVGVSQEVMEAFVEKESEK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcatataaccttttaaaaggaaaaaaaggaatcattttcggggcattagatgagaat
tctattgcatggaaaaccgctgtgaaagcgcacgaagaaggtgctgaaattgtacttacc
aacgcgccaatcgccatgagaatgggaagtattaaaactttagctgagcaaattggtgct
gaaattgttcctgcagatgctacaaaagttgaagatttagaaaatcttgtagacaaagct
acagaaatccttggaggcaagatcgattttgtacttcactctatcggaatgtctgtaaac
gtaagaaaagggaagcactataccgatcaaaattatgactggacagcaaaaggttgggat
gtatctgcggtttctttccataaaaccatgcaggcactttatcaaaaagatgccatgagt
gaatgggggagtattgtagcactttcgtatatggcagcgcaacgcgtattcccagattat
aacgatatggctgataataaggcgtatttggaaagtatagcacgtagttttggttatttc
ttcgggaaagaaaaaaaggttcgagttaataccatttctcaatccccaacaccaactact
gccgggcagggggtaaaaggttttgacggttttattgcgtatgcagataaaatgtctcca
ctgggtaatgctaccgctcaggattgtgccgattataccatcacactgttctctgatctt
actaaaaaagttaccttacaaaacttatatcacgacggagggttctctaacgtaggcgtt
agccaggaagttatggaagcatttgttgagaaagaaagcgaaaaataa

DBGET integrated database retrieval system