KEGG   Zunongwangia profunda: ZPR_3767Help
Entry
ZPR_3767          CDS       T01216                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00380  Tryptophan metabolism
zpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ZPR_3767
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     ZPR_3767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADF54075
UniProt: D5BLE9
LinkDB All DBs
Position
complement(4070091..4071368)
Genome map
AA seq 425 aa AA seqDB search
MQFENSRLFAQQLDTKDPLAKYRNEFIFPQINNKNAIYFTGNSLGLQPKLAQSYVNEIMN
DWGNLAVEGHFRAKKPWWDYHERFANQLSKVVGAKPTEITVMNTLTVNLHLMMVSFYRPT
TKRYKIICEEKAFPSDQYMIASQVRFHGLNPEDAIVELKKRDGEHNFRTEDILAKIEEVG
EECALILIGGVNYYTGQVFNMKTITEAGHKIGAFVGWDLAHAAGNIKLALHDWNVDFAAW
CSYKYMNSGPGNVSGCFVNEKYHNKKDIPRFEGWWGHNKDRRFLMEPEFQPEDGANAWQI
SNAPVLALAPYLASLQMFDEVGMDALIEKRNKIVAYLEFILHEIDKEVESSFEIITPSNQ
EERGTQLSVFLHGEGKELFNYLMENGVIPDWREPNVIRLAPAPFYCSYEDMYEFGQILKR
GILEK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgaaaattcccgtttatttgctcagcaattagatactaaagatcctttagca
aaatatcgcaatgaatttatttttccgcagatcaataataaaaatgcgatctattttacc
ggcaattctttagggttacagccaaaattggcacaaagttatgtaaatgaaataatgaac
gattggggtaatctggctgtagaaggacattttcgagccaaaaagccctggtgggattat
catgagcgttttgcaaatcaattatccaaagtggtaggcgcaaagccaacagaaattaca
gtgatgaatacgcttacggtaaacttgcacttaatgatggtgtctttttatcgtccaaca
acaaagcgttataaaatcatttgtgaagaaaaggccttccctagcgatcaatatatgatt
gcgagtcaggttcgtttccatggtttaaatcctgaggatgctattgttgaactaaaaaag
cgggatggtgaacataattttagaacagaagatattcttgcgaaaattgaagaagtagga
gaggagtgtgctttgattttaattggaggcgtaaattattataccgggcaggtttttaat
atgaaaaccattaccgaagcagggcataaaattggtgcttttgttggatgggatttagcg
catgccgccggaaatataaaattagcattgcatgattggaatgtagattttgcagcatgg
tgtagttataaatacatgaatagcggaccgggaaatgtttcgggttgttttgtaaatgaa
aaatatcataacaaaaaagatattccgcgttttgaaggctggtggggccataataaagac
cgccggtttttaatggaacccgaatttcagccagaagatggagcaaatgcatggcaaatt
agtaatgcgccggttttagcgttggcaccctatttggcctcgttacaaatgtttgatgag
gttggcatggatgctcttattgaaaagcgaaataaaattgtggcttatctcgaatttata
ttgcacgaaattgataaagaagtggaaagcagttttgaaatcatcactccgtcgaatcag
gaagaacgcgggacacaattatctgttttcttgcatggtgagggcaaagaactttttaat
tacttaatggaaaacggtgtaatcccagattggcgtgaacctaatgtaattaggttagcg
ccggcaccattttactgttcttatgaagatatgtacgaatttggccaaatcttgaaaaga
ggtattttagagaagtaa

DBGET integrated database retrieval system