KEGG   Zygosaccharomyces rouxii: ZYRO0A08448g
Entry
ZYRO0A08448g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:zro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    ZYRO0A08448g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zro01001]
    ZYRO0A08448g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ZYRO0A08448g
Protein kinases [BR:zro01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   ZYRO0A08448g
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase
Other DBs
NCBI-GeneID: 8201979
NCBI-ProteinID: XP_002494735
UniProt: C5DQ41
LinkDB
Position
A:complement(677122..678225)
AA seq 367 aa
MNLELVTNTEVVHKQVYCGHPSGNNGENEPAEITYPTTEVVGHGSFGVVFTTTIKETDED
VAIKKVLQDRRFKNRELEIMKLLKHPNIIDLKYYFYEKDSHGEVYLNLILDYMPQSLYQR
LRHFVHIPSAMPRLEIKCYMYQLFKSLNYLHNFALVCHRDIKPQNLLVDPNTCALKICDF
GSAKQLKPTEPNVSYICSRYYRAPELIFGATHYSNQIDVWSSGCVMAELLLGQPMFPGES
GIDQLVEIIKILGTPSRQEICAMNPNYMEHKFPQIKPIPLSRVFKKEDEQTVQFLADTLK
YDPMERFNALQCLCSSYFDELRHAQGQLKQIVDSLQLLQFEYDTELAHLTQDQLEAVRLK
LQPTQIR
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaatttagaacttgtaacgaataccgaagtggtacacaagcaagtgtattgcggtcat
ccttcaggtaataacggggaaaatgaacctgcagaaattacatatcctactacagaggtt
gtaggacatggttcatttggtgttgttttcactactactataaaggagacagacgaggat
gtagctataaagaaagttttacaagatcgtcgtttcaaaaatcgagaattggaaattatg
aagttgcttaagcaccctaatataattgatttgaaatattacttttatgaaaaggattcc
catggtgaagtttatcttaatctgatattggattacatgcctcagtcattatatcagcga
ctgaggcactttgtacacatcccaagtgcaatgccaagattggagattaagtgctacatg
tatcagctgttcaaatcattgaattatctgcataattttgcattagtttgtcatagagat
attaaacctcaaaatttattagtggatccaaacacatgtgctctgaaaatctgtgatttt
gggtctgcaaaacagttaaaaccaacggaaccgaacgtttcctacatttgctctcgttat
tatagagcaccagagttaatctttggagctactcattattcaaatcagattgatgtctgg
tcaagtggatgtgttatggcagaactacttttaggtcaaccgatgtttccaggtgaaagt
ggtatcgatcaattagtagaaattataaaaattttaggtacaccttcgcgtcaagagata
tgtgctatgaacccaaattatatggaacataaatttcctcaaattaaaccaattcctctt
tctagggtctttaagaaggaagatgagcaaacagttcaatttctagccgacactctaaaa
tatgatcccatggaaagatttaacgcattgcaatgtctatgttcttcttattttgatgaa
ttacgtcacgctcaaggtcaattaaaacaaattgtagactcattacaactattacaattt
gaatatgatacagaattggcccatctgacacaggatcaattggaggctgtcaggttaaaa
ttgcaaccaacgcagatacgatga

DBGET integrated database retrieval system