KEGG   Zygosaccharomyces rouxii: ZYRO0B14542gHelp
Entry
ZYRO0B14542g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K17278  membrane-associated progesterone receptor component
Organism
zro  Zygosaccharomyces rouxii
Brite
KEGG Orthology (KO) [BR:zro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zro04147]
    ZYRO0B14542g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   ZYRO0B14542g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt-b5
Motif
Other DBs
NCBI-GeneID: 8202739
NCBI-ProteinID: XP_002495572
UniProt: C5DS78
LinkDB All DBs
Position
B:complement(1179820..1180401)
Genome map
AA seq 193 aa AA seqDB search
MAVVTDKKTDDLRIIYDSDDEDGGEDIGTTFTTLDIIRMLAGLIIAWCVVSRSFTNHWFY
IPGQNSVKKASKVSPEIPTYWSTQELPVSFTLEQLSQYTGQGESGRILLSVKGHVFDVTE
GESFYGKWGAYRKFAGTDCSNLFGYHMWDVSALGRKCNHDLSGLSEQEMSRVNSWLEYFK
GKYPEVGYLEEDQ
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagttactgataaaaagactgatgatttgagaattatctatgattctgatgac
gaagatggcggtgaagacatcggtactactttcactactctcgatattattcgtatgtta
gcgggtttaataattgcatggtgtgtagtgagtaggtcatttaccaatcattggttctac
atcccgggtcaaaattcggttaagaaagcttctaaagtatcaccagagatccctacctat
tggtcaactcaagaattacccgtttcatttacactggagcagttgtcacagtatacaggt
caaggcgaatcaggaagaatactacttagtgttaaggggcatgtattcgatgttactgaa
ggagaatcgttttatggtaaatggggagcatataggaaatttgcaggtaccgattgttcc
aatttattcggctatcacatgtgggatgtttcagcacttggtaggaaatgtaatcatgat
ttaagtggtttatcggagcaagaaatgtcaagggttaattcttggttagaatattttaaa
gggaagtatccagaggttggatacctcgaagaagatcaatga

DBGET integrated database retrieval system