KEGG   Zygosaccharomyces rouxii: ZYRO0B14718gHelp
Entry
ZYRO0B14718g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
Organism
zro  Zygosaccharomyces rouxii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_clus
Motif
Other DBs
NCBI-GeneID: 8202747
NCBI-ProteinID: XP_002495579
UniProt: C5DS85
LinkDB All DBs
Position
B:1196539..1199646
Genome map
AA seq 1035 aa AA seqDB search
MSSGGEGGLSGTLLPAFSGSSSGIGSDIGNSNKNNNNTGGMQSRDSDSSAINVNEEGVIV
GDNEQPGRVNVRACTLIKGAAAHDPRIIEPTQMETSEGGKLKRNSFACISCHSLKQKCVP
SDFNDIYRKPCIRCLKNGKLCRFDLSKRTRKRKRRGSPLSSPSSTSPKLDLRNGHDVGGG
FRKEYPISVSNNNNSIHRRPYSHDILQNDQHPISETWSSQSHTPTPIDTPTGFNAPSTSA
TAAAASMAAASAASAYPGGYQGGFSSGIPSGYPAGYTSGYPSGFAGGVPIMLNANGAPAV
SMPSVLLGNHQLGEMPGNMASTISMQDPTSVNNTDGDNGGARDLNSSTGGSSTVGNVVTA
NSGNITNNNDKNSTDGSGSGLLPNRRGIDEKSGVAKEEPASSLKRRNSLFKGQLHDLLTN
QKDKIGQISSSLNSLSKQWDTLIQSTMSITSSSDPVSLGVILPDEAEVRLQIFLHDVVPK
VNLPFISLSADINADQLRRNKPILFSTIMSCVSGMMTQENSNKETNMKLDSFLLDLITDQ
IFKANNKSIELIESLLTLCFWYNFPEWAHKARYHIFNYVCVCLAKEMGPTFMHRAFGMFL
EEDPSSTQHPITAPLDQYEDGARLILLVYISSLNISIFLRQSIKARWSPTIEQACSNICK
RMLGENNAFNDDDKTLVVFARLNHILERIHINLHEHSAVDLPYSKECEPTQTHLDHLISK
FKYDLSELFKEIPEDRHRVIAYFYSVEAYLYQYIIDSYIEKMPTKFGIGPLPANISDAFL
RCYDFCARTLGEFVKLTPKLVASLPLFHSSRIIYTVGMLLLKLRYSAMALPAFQQFQHST
EDAVFLVTEVSKLLEESSNIFIFNNFLYKLRYVVALFVQTYGNKVKALVNSSDIRRSSTT
NEIKSDETSRTFTTGSTEVPTKATTNTKTTTGIMEPPSNLPDPNNVILNTAYPAITNTDM
ISPSQTSNNQEFDNRMGLPTTSSHDKVSSNSPDIQPPSATSSGNINDYLTDVDSIILGFN
ALNDEFWTDIFSNDL
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggtggcgaaggaggtttgtctggcacgcttcttcccgcatttagtggtagt
agtagtggtattggtagtgatattggtaatagtaacaagaataataataatactggtgga
atgcagagcagggatagtgacagctctgcaattaatgtaaatgaggaaggtgtaatagtt
ggggataatgaacaaccaggtcgcgtcaatgttcgtgcctgcacattgattaagggtgct
gcagcgcacgatccaagaattatagaaccaactcaaatggagacaagcgaaggcggtaaa
ttgaaaaggaattcatttgcatgcataagctgtcactcactaaagcaaaaatgtgttccg
tctgattttaatgatatttacagaaaaccttgcatacgttgtttaaaaaatggtaaattg
tgcagattcgatttgtcaaagagaactagaaagagaaagcgccgtggttctcctctttct
tcaccttcaagtacttcaccaaaattagatcttcgtaatggacatgatgttggcggtggg
ttcagaaaggaatatccaatatctgttagtaataataacaattccatacaccgtcgtccc
tactctcatgatattttacaaaatgatcaacatccaatctctgaaacgtggtccagtcag
tcccatacaccgacaccaatagacacaccaaccggttttaatgccccatccacatcagct
actgcggccgctgcatcaatggctgctgcctcagctgcaagtgcgtacccaggtggatat
caaggtgggttttcaagtggaattccaagcggatatcccgctggttatacaagcggatat
cccagtgggtttgccggcggagtccccattatgttaaatgcaaatggagctccggcggta
tcgatgcctagtgtcctacttggtaatcatcagttgggggaaatgccaggaaatatggct
tcaacaatttcaatgcaggaccctacttcagtaaacaacactgacggtgacaacggtggt
gctcgcgacttaaattctagtaccggcggctcttctactgtcggtaatgtagtgacagca
aacagtggtaatatcaccaacaataacgataaaaactctactgatggaagtggtagtgga
ttacttccaaatcgaaggggtatagatgagaaaagtggggttgcgaaagaagaaccagca
tcgtctcttaaaagaaggaattctctctttaagggccaattacacgacctgttaaccaat
caaaaggacaaaataggccagatatcttcatcgctaaactctttgagtaaacaatgggat
accttaatacagagtactatgtcgatcacttcgtcttcagatcctgtatcactaggtgta
atcctcccggatgaggctgaagttcgtcttcaaattttcttgcatgatgtggtacccaaa
gttaacttaccctttatcagcctttcagcagatataaatgcagatcaattgagacgtaat
aagcctatacttttctctaccataatgtcatgtgtgtctggtatgatgacgcaagagaat
tcaaataaggagaccaatatgaaattggattctttcctattggacctaataacagatcaa
atcttcaaggcgaataacaaatccattgaattaatcgaatctttactaacgctatgcttt
tggtacaattttccagaatgggcccataaggcgaggtatcatatttttaattacgtatgc
gtctgtttggctaaagaaatgggccctacatttatgcaccgtgccttcggtatgttcctt
gaagaagatcctagttccacacaacatccaataacggcaccattagatcaatacgaagat
ggtgcgcgcttgatcctattggtttatatctcttcattgaatatttccattttcctaaga
caatctatcaaggcgcgttggtcgcccaccatagaacaagcatgctcaaatatttgtaaa
aggatgttaggtgaaaacaatgcttttaatgatgatgataaaactttggtggtttttgcc
cggttaaaccatatattggagagaattcatatcaatcttcatgaacacagtgcagtggat
ctaccttatagtaaggagtgcgaacctactcagacacatcttgatcatctgatatcaaaa
ttcaagtacgacctaagtgagctattcaaagaaattcctgaagatcgtcacagagtgata
gcttatttctattcagtggaagcatacctataccaatacatcattgacagttatattgaa
aagatgccaactaaatttggtatagggccattgcctgcaaatattagtgatgcgttctta
agatgctatgatttttgtgctcgaacgttaggagaattcgttaaactaacacccaagctc
gtagcttcgttaccattgttccattcatcccgaataatatacaccgtgggtatgcttctt
ttaaaattaagatattcagctatggcgctacctgcattccaacagtttcaacactctact
gaagatgctgtttttcttgtgacggaagtttccaaattgttagaagagagctcaaatatt
ttcatctttaataatttcctctacaaattgcggtatgtggtggctcttttcgtacaaacc
tacggtaataaggtgaaggcattggttaattctagcgatattagacgatcatctaccact
aacgagatcaaatctgatgaaacttcacgtactttcacgacaggttcaacagaggtacca
acaaaagcaacaacaaatacaaaaactacgacagggatcatggagccgcccagtaatcta
cctgatccaaataatgttatattaaacaccgcatatccggctattactaacacagacatg
atttcgccgtcccagacctctaacaatcaagagtttgataaccgtatggggcttccaaca
acgtcttcccacgataaggttagctcaaattctcctgatatacaaccaccatctgctact
tcaagtggaaacattaatgactatttaacggatgtcgattcaataatattggggttcaat
gcattgaacgacgaattttggacagatattttctcaaacgacctttaa

DBGET integrated database retrieval system