KEGG   Zygosaccharomyces rouxii: ZYRO0C10736gHelp
Entry
ZYRO0C10736g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00020  Citrate cycle (TCA cycle)
zro00190  Oxidative phosphorylation
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
zro01130  Biosynthesis of antibiotics
zro01200  Carbon metabolism
Module
zro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
zro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
zro_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:zro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZYRO0C10736g
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ZYRO0C10736g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ZYRO0C10736g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3 GIDA Thi4 HI0933_like DAO NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 8203327
NCBI-ProteinID: XP_002496111
UniProt: C5DTR7
LinkDB All DBs
Position
C:823644..825578
Genome map
AA seq 644 aa AA seqDB search
MLSLRKSAVQSAVSRLSLVKRSFQTTPRVLQTQGDVGGESAPGSLGNGKYHIVDHEYDCL
VVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHPDDWKWHMYD
TVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTESGRIYQRAFGGQSRDRGKGGQ
AYRTCAVADRTGHALLHTLYGQALRHNTHFFIEYFALDLLTHNGEVVGAMAYNQEDGTIH
RMRAHKTIIATGGYGRTYFSCTSAHTCTGDGNAMVARAGFPLQDLEFVQFHPSGIYGSGC
LITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVVSRSITMEIREGRGVGKEKDHIY
LQLSHLPPSVLQERLPGISETAAIFSGVDVTKQPIPVLPTVHYNMGGIPTKWNGNALTID
PETGEDKEIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTVSDELQPGLPHKP
LPTDLGRESIANLDKIRNATGSRPTADIRLAMQKAMQKDVSVFRTQETLDEGVKNVLAID
KTLEDVRTTDRSMIWNTDMVETLELQNLLTNATQTASSAANRKESRGAHAREDYPDRDDA
NWMKHTLSWQTKSGDDVKIKYRNVASQTLDESEVSSVPPAIRSY
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgcttagaaaatctgctgttcaatctgcagtatcacgtctttcactagttaaa
agatcattccaaacaacgccaagagttttacagactcaaggtgatgttggtggtgaatct
gctccaggttcacttggtaatggtaaataccatattgttgaccacgaatacgactgttta
gtcgttggtgctggtggtgcaggtttgagagctgcattcggtttagctgaagctggttac
aaaaccgcttgtatatcaaaattgttcccaaccagatctcacaccgtggcagctcaaggt
ggtatcaatgctgccttgggtaacatgcaccctgatgactggaaatggcacatgtatgat
accgtcaaaggttctgactggcttggtgaccaagattccattcactatatgactcgtgaa
gctccaaaatccatcattgaattagaacactacggtgttccattttccagaactgaaagt
ggtcgtatctaccaaagagcatttggtggtcaatcaagagatagaggtaaaggtggtcaa
gcttaccgtacttgtgcggttgccgatagaaccggtcatgctcttttgcatactttgtat
ggtcaagctctaaggcataacactcatttcttcatcgaatattttgctcttgatctattg
actcacaacggtgaagttgttggtgctatggcttacaaccaagaagacggtaccattcat
agaatgagagctcacaagactatcatcgctactggtggttatggtagaacttacttcagt
tgtacttccgctcacacctgtaccggtgatggtaatgctatggttgctcgtgctggtttc
ccactacaagatttagaatttgttcaattccatccatctggtatctacggttctggttgc
ttgatcaccgaaggtgctcgtggtgaaggtggattcttgctcaactctgaaggtgaacgt
ttcatggaacgttatgccccaactgctaaggatttagcaagtagagatgttgtttctcgt
tccatcactatggaaattagagaaggtagaggtgttggtaaggagaaggaccacatctat
ttgcaattgtcccacttgccaccttctgttctacaagaaagacttccaggtatctctgaa
accgctgctatcttttctggtgttgatgtcactaagcaaccaattcctgtcttgccaacc
gttcactacaacatgggtggtatcccaaccaaatggaatggtaacgcattgaccattgac
ccagaaaccggtgaagacaaagaaattccaggtttgatggcctgtggtgaagctgcctgt
gtttccgtccacggtgctaacagattgggtgccaactctttgctagatttggtcgtcttt
ggtcgtgctgttgcccacaccgtttctgatgaattacaacctggcttgcctcacaaacca
ttgccaacagacctaggtagagaatctattgctaacttggataagataaggaatgcaact
ggttccagaccaaccgccgacatcagattggcaatgcaaaaggcaatgcaaaaagatgtc
tctgtgttcagaactcaagaaactttggacgaaggtgttaaaaacgtcttggccattgac
aagactttggaagacgtccgtaccactgatagatcaatgatctggaacacggatatggtc
gaaactttagaattgcaaaacttgttgactaacgctactcaaaccgctagctctgccgcc
aacagaaaggaatctcgtggtgctcacgctagagaggattacccagacagagatgatgct
aactggatgaagcacactctatcttggcaaactaaatctggtgatgacgtcaagatcaag
tacagaaatgtcgcctctcaaacattggatgaatcagaagtttcatctgttccaccagct
atcagatcctactaa

DBGET integrated database retrieval system