KEGG   Zygosaccharomyces rouxii: ZYRO0D05852gHelp
Entry
ZYRO0D05852g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K13341  peroxin-7
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:zro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ZYRO0D05852g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 8203941
NCBI-ProteinID: XP_002496689
UniProt: C5DVD7
LinkDB All DBs
Position
D:498219..499334
Genome map
AA seq 371 aa AA seqDB search
MLGYHMQGYSGYGVQYSPYFDNRLAVASGSNFGLVGNGKLFILDIDPQGRILEFNSFLTQ
DCLFDVAWNEAHENQVLVAQGDGTLRLFDTKLKQYPIAIFNEHQKEVFSCNWNLVGKQNF
VSSSWDGAVKIWSPQRKESLLTVVPRPMDVSTMACAGPQVPMSNQKGHADIAKNKNCIYQ
ALFSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFNKYRPHSLVT
GGVDNCIRIWDLRMVGPSAASRANASPAVCTNEIVGGHELAVRKVSWSPHHSNILLSTSY
DMTCCIWQDLGFDGRRSTGRTNSVDPRRGCRSRFAQHTEFVYSADWCLWGQPGHIASTAW
DGNVFIWNAFR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatatcatatgcaaggttacagcggatatggagtccaatattctccgtacttt
gataatcgattggcagttgcatcaggatcaaattttggattagttggtaatggtaaatta
tttatactagatatcgatccacaaggcaggatattagaattcaattcatttttaacccag
gattgtctattcgacgtagcatggaatgaggcacatgaaaatcaggtactcgtggctcaa
ggcgatggtacattacgtctttttgatacgaaattgaagcaatatccaattgccatcttt
aacgagcatcaaaaggaagtattcagttgtaattggaatttagtcggtaagcagaatttt
gtaagcagttcatgggatggtgctgtcaaaatatggtcacctcagaggaaagagagtctt
ttaacagtggtccccaggcccatggatgtctccacaatggcatgtgcaggtccacaagtg
ccgatgtcaaaccaaaaagggcatgcagatatcgccaaaaataagaattgcatataccaa
gcactcttctcacctcatgatcctaacttagtgatgtgttgttcaggtaattcatatgtg
acgttattcgattcaaggcagccaccaacacctgcaaaccaaaaatcattcttagcacat
tctggactagaagcactaacttgcgattttaacaaatacagacctcatagcttggttacg
ggtggtgtagataattgcataagaatttgggacctaagaatggtgggaccttcagcggca
tctcgtgctaatgcatcgccagcggtatgtacgaatgaaattgttgggggccatgaacta
gcggtaaggaaagtctcatggtcacctcatcattcaaacattttactgagtacctcctac
gatatgacatgttgcatttggcaggatcttggattcgacggtagaagatctactggtaga
actaacagcgtggatccaagaagaggttgtagatcaagatttgctcaacataccgaattc
gtgtattctgcagattggtgcctctggggtcaaccaggtcacattgcatccactgcatgg
gatggtaacgtcttcatatggaatgcatttcgttaa

DBGET integrated database retrieval system