KEGG   Zygosaccharomyces rouxii: ZYRO0D05918gHelp
Entry
ZYRO0D05918g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
Organism
zro  Zygosaccharomyces rouxii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N ENTH
Motif
Other DBs
NCBI-GeneID: 8203944
NCBI-ProteinID: XP_002496692
UniProt: C5DVE0
LinkDB All DBs
Position
D:500845..505863
Genome map
AA seq 1672 aa AA seqDB search
MSLPLKPLTIDSNSKQLDSKEKKFKNHVTRALENFDSVTEWADYIASLGRLLKALQSWTP
QFQNVKYYVPSPYQVSRRLASSLSPDLPAGVHQKTLDVYTFIFEKIGQDNLAAECNIWIP
GILPLMTYASMSVKSHLVEVYDNYLVQLPSSTLKLLAKPLLASLLPGIDDESSEFQPVTM
NLIDTLRENMDNDSLFWQSCFLVMITSKERRLGGLVWLIKKFPSLNSVPHLVIERNKRIE
TTGGIDKMNPKELREDAFSTLQPAAKSLLSPEPGLLIRCLVSSLRGDNDLLIKRGIWDLL
LQRLHLESPVLNQLISVGDKKLLVMACCKTILDKDMSLNRRIWNWLLGPAAASSMNNAGA
LTDQVVEDSNEYFLKYGFDSLIDGLKDMIGTQESVTTAINICISLMDRWQIGSLVVPEMF
IPLLLATKRFAQNPQVMKISSIFFDTVETNIIWGKIFQYIMDSKDLEFLKFVLHSYNVAN
EEEIVVRHLPLILLTILSSNDFQKEDSSNGRYSICHQLLEILPERAFLPLNFTQMSFDSE
IDTKDVLKKISDYYHGVSDPVSLQTVEDSVDVLPPFNTEDLTFLIVHCAHDTLLENLKSG
ENIAEATRIFVGVCERVPESNAEKDGPSNDLSDDSLVEAIFMCLNNPEKKTGSVYGIVDL
YTNYLASRIGFIQSVKLLKLIISSLWNYLVEPRRQLMAVKGLKLLQKCRYADYVEGALSS
AFIEEKDISRCLVVLELLWNQLEPNSAVLRRPVELMADELFDEQNPHYLSVSKWILSVVN
SGSSNRLFYLLTDDLLKFDFLKRDYLQDLDDLDMFTYRLQCLTSILKSNNNVVLESFTTE
LTTIGSLADWENEDVSTYKNLVIVIIMRFLHLKNNNNATSIRSALLLLEYLLNGSEQNFK
WIVMFLLQMSSEYISKEGLESDLIAVSLLNIVSKVLRLSHENGIKLDVFDDNTTHLKYVD
YLITSVASMESPLIVTSYVKLLRESLAYFESSIFRMILPLTASIVQCVHKLLDKEKKDGG
YYQSIALLLAGLEELLEVSHKFLLADENEGYFSAAGSRGDFLQSMVSNVFSSDVSANDVK
VQGERDVILQSFKEVVTCTFHIWSWAHEVSANATRTPESEQTNHNSYKFKFTAKKLLEKL
FLLEPLEVMEDLVIAPTDNDKLTLIHVLDGNRPALTIPYFFIGIVYRQNKNGSVKFSVNS
GNTKTSGNHLDSSLMHKLDSKALMHFLLNYASSLENAAIEDFYGDFAAFLKEVSANYNLY
GTVSTSVLKFVGIIAEKLNKSRFGEQKRIRRELAETFTKYLPNALSDSPLDYENPYQSFE
NLECVVKSLQYILNDSVGGEKYNSSLHTIVNQCITPYFKSKTETVVPEYVLKLSLEIAKV
GEKVKNWRLLVNDFFMDEKKFILVENPIWKEIMYHWSHYPENKSKVINDLITAVDTKVAG
MISFNSWSDSENDAKAQNILRLSFLLLISPVDSYLLQFQSLISLACEYLVSKNVKLKSKC
WILLRALFLRFSDSHFNEHWSMLTYSLQTNLQEFFESLHIREEMDVGLLLQTCKTLDLLL
ALNFEGFSGTNEWLFVIDTINCIYKEYPFVALVDEIYEFKEFERRTVEDVEPLDKIQSQV
PLLAGVSSIKSYTQLKNFFQNLSYVHYEYIYSLKGVDMVECENDLFTDIFFT
NT seq 5019 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgcccttaaaaccgctcacaattgattcaaatagcaagcaacttgattccaag
gaaaagaagttcaagaaccatgtaacaagggcattagagaacttcgattcggtgacagaa
tgggcagattacattgcaagtttaggtagactgcttaaggcattgcagagttggacacct
cagtttcaaaatgttaagtattatgtgccatcaccttaccaggttagtagaagactagcg
tcatcactatcgccagacttacctgcgggtgtacatcaaaagaccttggacgtttacact
tttatttttgaaaagattggtcaagataatctggcggcagaatgtaatatttggattcca
ggtatcttgccattgatgacatatgcgtcgatgtccgtcaagagtcatctggttgaagtt
tacgacaactatttggtacaattgccatcatcaacattaaaactgctggcaaaaccgttg
ttggctagtctacttccaggaattgatgatgagagtagtgagtttcaaccggttacgatg
aacttgattgatactttaagagaaaacatggataacgactctttattctggcagtcgtgc
tttttagtcatgattactagtaaagaacgtaggttaggtggattagtatggctcataaag
aaatttccttcattgaattctgtgccgcacttggttatagagagaaacaaaagaatcgag
actacaggtggtattgataagatgaatcccaaggaattgagggaagatgcattttctact
ctgcaacctgcagcaaaaagtctactttcgccagaacctggtctattaatacgttgtctg
gtgtcttcactaagaggtgacaatgatttactgattaaaagaggtatttgggatttactt
ttacaaagattgcatctagagtctccggtattgaaccaactaataagtgtcggggataaa
aaattgttagtcatggcctgctgtaagacgattttggataaggatatgtctttgaataga
agaatatggaactggctattgggaccagcggcagcttcttcgatgaataatgctggtgca
ttaacagatcaagtcgtggaagatagtaatgaatatttcttaaagtatggctttgacagt
ctgatagatggtctgaaagatatgattggaactcaagagtctgtgactacagcaatcaat
atttgcatttcattaatggataggtggcagattggttcattggtggtcccggaaatgttc
ataccactgttattggcgactaagcgctttgcacaaaatcctcaagtgatgaagatatct
agcatttttttcgataccgtggagaccaatatcatttggggtaaaattttccaatacatt
atggacagcaaagatcttgaattcttaaaattcgtcttgcactcttacaatgtcgccaat
gaggaggaaattgttgtacgtcatttgcctctgatccttttgactatcctctcctctaac
gatttccaaaaggaagactcatcaaatggtcgttattccatctgtcatcaattgcttgag
attttgcccgaaagggcattcttaccgctaaattttactcagatgagtttcgacagtgaa
attgataccaaagacgttttgaagaaaatttcggactactatcatggagtttcagatcca
gtctctttgcaaaccgtggaagactctgtggatgttttgcctcctttcaataccgaggat
ttgactttcctcattgtccactgtgctcatgataccttactagaaaatctaaaatctggt
gaaaacattgcagaggcaacaagaatttttgttggtgtctgtgaaagagtaccagaatct
aatgctgagaaagatgggccctcgaacgatttatccgatgattcgctagtggaagctatt
ttcatgtgcctaaacaatccagagaagaaaaccggctcggtgtatgggattgtggatctc
tacactaactatttggcctcgagaataggcttcattcaatcagtcaagctattaaaatta
atcatttcatcgctatggaattatttggtagaacctcgtagacaattaatggcggttaaa
ggtttaaaacttttacaaaaatgtcgctatgcggactacgttgagggtgccctttcaagt
gcattcatagaggaaaaggacatatcaagatgtttagtggtattggaattactttggaat
caattggaacctaattccgctgttttgagaagaccggtggaattaatggctgatgaactt
ttcgatgaacaaaacccccattatttgagtgtatccaaatggattttatccgtggttaat
tcgggttcttcaaacagactattttatttactaacagacgatctactgaaatttgatttt
ttaaagagggattatctgcaggacctggatgaccttgatatgtttacataccgtcttcaa
tgtttgacgagcattttaaagagtaacaacaatgtcgtattggagagttttacaactgaa
ttgaccaccattggctctttagcagattgggaaaatgaagatgtttccacttacaagaat
ttggtcattgtaattataatgagatttttgcatttgaaaaataacaataacgctactagc
ataagaagtgccctcctactattggaatacttgctaaatggttctgaacaaaacttcaaa
tggattgttatgttcttattacagatgtcatctgaatatatttcaaaggagggcttggaa
tcagatctaatagcagtctctttgctgaacatcgtatccaaagtgctaagattatctcat
gagaatggaattaagcttgatgtgtttgatgataatactacgcatttgaaatatgtcgat
tatctgattacaagtgttgcttcgatggaaagcccactcattgtgacctcctatgttaag
cttttgagagaaagtttggcttattttgaaagctctattttccgcatgatattgccgctc
acagcttctattgtccaatgtgtgcataaacttttagacaaggaaaagaaagatggcgga
tattatcaatcgattgcattacttcttgctggtttagaagagttgttagaagtgtcacac
aaatttttactagctgatgagaatgaaggatacttctctgctgcgggatctcgtggtgat
ttcctccagagcatggtttctaatgttttttcctctgacgtctcagcaaacgatgttaag
gttcaaggtgaaagggatgttatactacaatcatttaaagaggttgtaacttgtactttc
cacatatggtcatgggctcatgaagtttctgctaatgctaccaggactccagaatctgag
caaaccaaccacaattcttataagtttaaattcactgccaaaaaattattggagaaatta
tttttgctagaacctttggaagtaatggaagatttagtaattgcacctacggataacgat
aaattgactttgatacatgtgctggatggtaacaggcctgccttgacaataccatatttt
tttattggtattgtgtatagacaaaataagaatggcagtgttaagttttcggtcaacagt
ggtaacaccaagactagcggcaaccatctggattcctccttaatgcataaattggattct
aaggcattgatgcatttcttgttaaactatgcatcgtccttggaaaatgctgccatcgaa
gacttctacggtgattttgctgccttcctaaaagaggtcagtgccaactacaatctttat
ggtaccgtctctacttcagtattgaagtttgtgggtattattgctgagaagcttaataaa
tctagatttggagagcagaaacgtattaggagggagttggcagaaacatttacaaaatac
ttgcccaatgccctatcagattctcccctagattacgagaatccctaccagtcatttgaa
aatctggaatgtgtggtcaaaagcttgcagtatattttgaacgattctgtgggaggtgag
aaatacaacagttcacttcatacaattgtcaatcaatgtattacaccttatttcaaatcg
aaaactgaaacagtggttccggagtacgtcctgaagctttctctagagatcgctaaagtc
ggtgaaaaggtgaagaattggagacttttggttaatgatttcttcatggatgagaagaaa
tttatacttgtggaaaatccaatttggaaagaaatcatgtatcattggtcccactatccg
gagaataaatcgaaagtgattaatgatttgataactgcagtggacacaaaggtggctggt
atgatatcgttcaattcatggagtgattctgaaaacgatgccaaggcacaaaacattctg
agactctcctttctgctcctgatttctccggtagattcttatctgttacaattccaatct
ttgatttctttggcatgtgagtatcttgtctccaaaaatgttaaattaaaatccaagtgt
tggatattgttgagagcccttttcttgagattctcagattcacatttcaacgagcattgg
tccatgttaacctatagtctacagactaatttacaagaatttttcgaatcgctacatatt
cgagaagagatggatgtgggtctgttgttgcaaacatgtaagaccttagatcttttactg
gcattaaattttgaaggatttagtggtacaaacgaatggctgtttgtcattgatacaatt
aactgcatttacaaagaatatccatttgtggcattagttgatgagatctacgagtttaaa
gaatttgaaaggagaaccgtagaggatgtggaaccactagataagatacagtcacaggta
ccattgctggctggtgtgagttccattaagagttatactcaattaaagaattttttccaa
aacctaagttatgttcattacgagtacatctacagtttgaaaggagtcgatatggtagag
tgtgagaacgatttatttacagatatcttttttacctaa

DBGET integrated database retrieval system