KEGG   Zygosaccharomyces rouxii: ZYRO0D05940gHelp
Entry
ZYRO0D05940g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
zro  Zygosaccharomyces rouxii
Brite
KEGG Orthology (KO) [BR:zro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:zro03012]
    ZYRO0D05940g
Enzymes [BR:zro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     ZYRO0D05940g
Translation factors [BR:zro03012]
 Eukaryotic Type
  Release factors
   ZYRO0D05940g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Methyltransf_23 Methyltransf_25 PrmA Methyltransf_12 Methyltransf_33
Motif
Other DBs
NCBI-GeneID: 8203945
NCBI-ProteinID: XP_002496693
UniProt: C5DVE1
LinkDB All DBs
Position
D:complement(505874..506542)
Genome map
AA seq 222 aa AA seqDB search
MLPTPYIKCDYETVYEPCEDSFLLLDGLEQEQSFLQTRFRNQLAIVCELGPGSGIVTTFL
MQNDIPHGNGSIYLALDISPWALEATQDAQRRNDCQNRYLSVIQSDLTKCLRQNSTDLLV
FNPPYVPAEQVPDRPSSNENDKSQWLDLALLGGEDGMVITRQVLDQLDTILSQQGVAYIL
FCARNKPEQVAESMRQQGWKVDLIINRKAGWEVLSIYRFIRQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgacaccgtacatcaaatgtgactacgagacggtttacgaaccctgtgaagac
agtttcctactgcttgatggccttgaacaggaacagtcgttcctccagaccagatttagg
aaccagttagccatcgtatgtgaactgggaccaggatccggtattgtaactacatttctc
atgcagaatgacataccacatggtaatggatccatctatttggccctagacattagtccc
tgggcccttgaagctacacaggatgcccagagaagaaatgattgccagaatcgttacctt
agcgtaattcaaagtgatttgactaaatgtctcagacaaaacagtactgatctactggta
tttaatccaccatatgtaccagctgaacaagttcctgataggccctcttcaaatgaaaat
gacaagagtcaatggttagatctagcacttttaggcggtgaagacggaatggttattact
cgacaggtgttggatcaattggataccatattgtcacaacaaggagttgcatacattcta
ttctgtgcaagaaataagcctgaacaagttgctgaaagtatgagacagcaaggttggaag
gttgatcttatcattaatagaaaggcaggttgggaagtactgagtatctatcgatttatt
agacaataa

DBGET integrated database retrieval system