KEGG   Zygosaccharomyces rouxii: ZYRO0D05962gHelp
Entry
ZYRO0D05962g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K12158  ubiquitin-like protein Nedd8
Organism
zro  Zygosaccharomyces rouxii
Brite
KEGG Orthology (KO) [BR:zro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:zro04121]
    ZYRO0D05962g
Ubiquitin system [BR:zro04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   ZYRO0D05962g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 8203946
NCBI-ProteinID: XP_002496694
UniProt: C5DVE2
LinkDB All DBs
Position
D:join(506710..506858,506936..507020)
Genome map
AA seq 77 aa AA seqDB search
MIIKVKTLTGKEIAVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAK
LVDGMQLHLVLTLRGGK
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgataatcaaagtaaagactctgaccggtaaggagattgcagttgaactaaatggcgaa
gatcctatctacaggatcaaagagttgttagaggagaaggaaggtattccaccatcccag
cagaggcttatattccagggcaaacaaatagatgatcaacagactgtttcctctgccaag
ctggtggatggcatgcaattgcacctggtgttgacattaagaggtggtaaataa

DBGET integrated database retrieval system