KEGG   Zygosaccharomyces rouxii: ZYRO0D09130gHelp
Entry
ZYRO0D09130g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00010  Glycolysis / Gluconeogenesis
zro00030  Pentose phosphate pathway
zro00051  Fructose and mannose metabolism
zro00052  Galactose metabolism
zro00680  Methane metabolism
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
zro01130  Biosynthesis of antibiotics
zro01200  Carbon metabolism
zro01230  Biosynthesis of amino acids
zro03018  RNA degradation
Module
zro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZYRO0D09130g
   00030 Pentose phosphate pathway
    ZYRO0D09130g
   00051 Fructose and mannose metabolism
    ZYRO0D09130g
   00052 Galactose metabolism
    ZYRO0D09130g
  09102 Energy metabolism
   00680 Methane metabolism
    ZYRO0D09130g
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ZYRO0D09130g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:zro01009]
    ZYRO0D09130g
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:zro03019]
    ZYRO0D09130g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ZYRO0D09130g
Protein phosphatases and associated proteins [BR:zro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ZYRO0D09130g
Messenger RNA biogenesis [BR:zro03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ZYRO0D09130g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 8204088
NCBI-ProteinID: XP_002496831
UniProt: C5DVS9
LinkDB All DBs
Position
D:784422..787298
Genome map
AA seq 958 aa AA seqDB search
MTVDIPLVNGTYSFTIKAYSEESFKKAIEFYKTFLLLEHRSDSATSALLFNGVVSLKIEL
QEDASKQREVDSVCEDLKANGSIKDWRGMVNESFVFKTGDILFSKQSLVDLKLPYQSYPN
EVSPMQVYTIDPLGNVIGVTSTKNAVSTKPTHPSIPDHEGRTTALTSKVPSYGDLKSADS
EPREKAVEASNVKAQKAIGIMTSGGDAPGMNACVRAVVRTAIHKGCRAYAIMEGYEGLVR
GGPEYIKEFTWDDVRGWSSLGGTDIGTARCMEFKERKGRLKGAQHMIEAGIDALIVCGGD
GSLTGADLYRSEWPSLVQELLETGVISQEQYDRYKHLNICGTVGSIDNDMSTTDATIGAY
SALDRILKAIDYVEATANSHSRAFVVEVMGRNCGWLALLAGISTSADYILIPEKPSSSRE
WEEQMCGIVTKHRQRGKRTTIVIVAEGAITNDLEPITSKDVHKILSGKLGLDTRITTLGH
VQRGGSPVAYDRILATLQGVEAVNAVLDSTPDTPSPLIAVNENKIVRKSLVDSVRLTKSV
ADAIQEKDFKKAMSLRDTEFIEHLNNFMAINSADHNEPELPSDKRLKIAIINVGAPAGGA
NSAVYSMATYCMSRGHKPYAIYNGWSGLCRHESVRSLDWASMLGWQSRGGSEIGTNRVTP
EEADIGMVAYYFQKYQFDGLIIVGGFEAFASLNQLERARDSYAAFRIPMVLIPATLSNNV
PGTEYSLGSDTSLNALVEYCDVIKQSASSTRGRVFVVECQGGNSGYLATSASLACGAQVS
YVPEEGISLDQLTLDIETLDKQFEMSEGRNRFGKLILTSGNASKAFSAEALAKVMTSESN
GMFEAKAAIPGHVQQGGLPSAIDRTRATRLSIKAVNFVEDQQDVMINARHDDDEFDVHDR
KLSQTAAVLGVRGSHVLFTSVRKLWDTETEIKNRTPKIIHWQATRDIADRLVDRKRID
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggatataccacttgttaatggtacttactcctttaccataaaggcctactca
gaggagtccttcaagaaggccattgaattttataagacttttttgcttttagagcatcgt
tccgactctgccacttctgctcttcttttcaatggggtggtctctttgaagattgaatta
caagaagatgcttccaagcagcgtgaagttgatagtgtttgtgaagatttgaaggcaaat
ggtagcataaaggattggagaggtatggtcaatgagtccttcgtcttcaagacgggagat
atccttttctcaaagcaatctttggttgatttgaaattgccttaccaaagctatcctaat
gaagtgtctcctatgcaggtctataccattgaccctctaggaaacgtcattggtgtcact
tctaccaagaatgccgttagtactaaacctactcatccaagtataccagatcatgaaggc
cgtactaccgctttgacatctaaggttccatcttatggtgacttgaaaagtgcagattct
gaacctcgtgagaaagctgtcgaggccagtaatgtgaaagctcaaaaggctattggtatt
atgacatcaggtggtgatgctcccggtatgaatgcatgcgtaagagctgtggtacgtaca
gctatccataagggttgccgtgcttatgctatcatggaaggttacgagggtttggttcgt
ggtggaccagaatatatcaaggaattcacctgggatgatgtgcgtggttggagtagtctt
ggtggtaccgatattggtactgctcgttgtatggaattcaaagaacgtaagggtagattg
aagggtgcccaacacatgattgaagctggtatcgatgctttgatcgtatgtggtggtgat
ggttctttgactggtgcagatttgtacagatctgaatggccatctcttgtgcaggaattg
cttgaaaccggtgtgatttctcaagagcaatatgatcgttataaacacttgaacatctgt
ggtactgttggttccattgataacgatatgtctactactgacgcaactattggtgcctac
tctgcattagacagaatcctcaaggctatcgactacgtggaggctaccgctaactctcac
tctagagctttcgtcgtcgaagttatgggtagaaactgtggttggttagctctactggca
ggtatttctacatctgcagactatattttgattccagaaaagccttcttcttctcgcgaa
tgggaagaacagatgtgtggcattgttacaaaacacagacaaagaggtaagagaactacc
attgtgattgtagcagaaggtgctatcactaatgatttggaaccaattacatctaaagat
gtgcacaagattttaagtggtaagctaggtttagacaccagaattaccaccttgggtcat
gtgcaaagaggtggttctccagttgcttacgaccgtatcttggctaccttacaaggtgtg
gaagcagtgaacgccgttttagatagtacacctgatactccatctccattgattgccgtt
aatgaaaataagattgttcgtaagtcattggtggattccgtcagattgaccaaatctgtt
gcagatgctatccaggagaaggactttaagaaagccatgtccttgagagatacagaattt
attgaacatttgaacaactttatggctattaactctgctgatcacaatgaaccagagttg
ccatctgacaagaggttaaaaattgccattattaacgttggtgcacctgcaggtggtgct
aattctgctgtgtactcaatggctacttattgtatgtctcgtggtcacaaaccatatgcc
atttacaacggttggtctggattatgtagacatgagagtgttcgctccttggattgggct
tcgatgttaggatggcagagccgtggtggttctgaaattggtaccaatagagtcacccct
gaagaagctgatatcggtatggttgcatactatttccagaaataccagtttgatgggtta
atcatcgttggtggtttcgaagcatttgcatcattgaatcaattggaaagagctagagac
agttacgctgcctttagaattccaatggttttgattccagcaactctatcaaacaatgtt
ccaggtactgagtattctttgggtagtgatacttctttgaatgctttggtggaatactgt
gatgtgattaaacaatctgcatcttccactagaggtagagtgtttgtcgttgaatgccaa
ggtggtaattctggttacttagctaccagtgcttctctagcatgtggtgcacaagtttct
tatgttcctgaagaaggtatttcgttggatcaattaaccttggatattgaaactttggat
aaacaatttgagatgtctgaaggtagaaacagatttggtaaattgattttaaccagtggc
aatgcatcaaaggccttctctgcagaagcattagcaaaggttatgacttctgaatctaat
ggtatgtttgaagctaaggcagctattcctggccatgttcaacaaggtggattaccatct
gcaattgacagaacaagagctactagattatccatcaaagctgtcaacttcgttgaagat
caacaagatgttatgatcaatgcacgtcatgatgatgatgaatttgatgttcatgataga
aaattatcacaaactgcagctgttctgggtgttagaggtagtcatgtcttgtttacatcg
gttagaaagctatgggatacagagactgaaattaaaaatagaactccaaagattattcat
tggcaggcaaccagggatattgcagacaggttagtcgataggaaaagaatcgattaa

DBGET integrated database retrieval system