KEGG   Zygosaccharomyces rouxii: ZYRO0E05016gHelp
Entry
ZYRO0E05016g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro00020  Citrate cycle (TCA cycle)
zro00480  Glutathione metabolism
zro01100  Metabolic pathways
zro01110  Biosynthesis of secondary metabolites
zro01130  Biosynthesis of antibiotics
zro01200  Carbon metabolism
zro01210  2-Oxocarboxylic acid metabolism
zro01230  Biosynthesis of amino acids
zro04146  Peroxisome
Module
zro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
zro_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:zro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZYRO0E05016g
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ZYRO0E05016g
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ZYRO0E05016g
Enzymes [BR:zro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ZYRO0E05016g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 8204701
NCBI-ProteinID: XP_002499150
UniProt: C5E4D4
LinkDB All DBs
Position
E:complement(379654..380889)
Genome map
AA seq 411 aa AA seqDB search
MMPKIQVKNPIVEMDGDEQTRIIWKLIKDLLILPFIDVDLLYYDLSITNRDATDDRVTVE
SAEATLKYGVAVKCATITPDEARVEEFHLKKMWRSPNGTIRNILGGIVFREPIVIPRIPR
MVSQWEKPITIGRHAFGDQYKATDTVIPDEGELKLVFKSKDGKHDQDLQVFEFPKGGGVA
MAMYNTTESIEGFAKASFELALERKQPLYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQF
EKLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPD
GKTFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPEVVKFGQLL
EKATVEVVDFENIMTKDLALILGKTDRSAYVTTEEFIHAVSKRLKGEVAKF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgatgccaaagatccaagtcaaaaatcccattgtggaaatggatggtgatgaacagacc
agaattatctggaaattgatcaaagatttgttgattttaccatttattgatgtagatttg
ttgtattatgatttgtcaattaccaatagagacgctacagatgatcgtgttactgtggag
tctgcagaggcaactttgaagtatggggttgctgttaaatgcgctactattactccagat
gaagcgcgtgtagaggaattccatttgaaaaaaatgtggagatcaccaaacggtactatt
agaaacattttaggtggtattgtctttagggaaccaattgtaattccaagaattccacga
atggtgtctcaatgggagaaaccgatcacaatcggtagacatgcattcggtgatcaatac
aaggctaccgatacagtcataccagatgaaggtgaattaaaattggttttcaaatcgaag
gatggtaagcacgatcaagacctacaggtctttgaatttcctaaaggcggcggtgtggcc
atggcaatgtataacactaccgaatccattgaagggtttgccaaagcttcgtttgaatta
gcattagaaaggaaacaaccgctgtattccaccactaaaaatacaatcttaaaaaaatat
gatggtaaatttaaggacatcttcgaagcaatgtatgaaaaggaatacagatcacaattc
gaaaagttggggatctggtacgaacaccggttaatcgatgatatggtagcacaaatgtta
aagtccaagggtggatacattatcgccatgaaaaattacgatggtgatgtacagtcagat
atcgtcgctcaaggatttgggtcccttggattgatgacatcagttctagtgactccggat
ggtaagacttttgaatcggaagctgctcatgggactgtcaccagacacttcagattacac
cagcaaggtaaagagacctctacaaactcaattgcatcaatctttgcatggacccgaggt
atcatccaaagaggtaaattagataatactccagaagtggtcaagtttggtcaattgttg
gaaaaggcaactgtcgaagtcgtagattttgagaatattatgaccaaagatttggcatta
atcctcggtaaaacggacagaagcgcatacgttaccacagaagaatttatccatgccgtt
agtaaaaggttgaaaggagaagtagctaaattttga

DBGET integrated database retrieval system