KEGG   Zygosaccharomyces rouxii: ZYRO0F02552gHelp
Entry
ZYRO0F02552g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
Organism
zro  Zygosaccharomyces rouxii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 8205064
NCBI-ProteinID: XP_002497308
UniProt: C5DX64
LinkDB All DBs
Position
F:203037..204092
Genome map
AA seq 351 aa AA seqDB search
MTKQDAIVLQKPGVITVDKRDVPEIKDPHYVKLHIKATGICGSDVHYYTQGAIGQFVVKS
PMVLGHESSGIVAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPP
YDGTLTKYYLAPEDFVYKMPDHLSFEEGALAEPMSVGVHANKLAGTRFGSKVLVSGAGPV
GLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSSDEERFVSEVSKVLGGDLP
NIVLECSGAQPAIRCGVKACKAGGHYVQVGMGKDDVNFPISAVGSKEITFHGCFRYKKGD
FADSVALLSSGRINGKPLISHRFAFDKAPEAYKFNAEHGNEVVKTIITGPE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcaagacgcaattgttcttcaaaagcctggtgttatcactgttgataagcgt
gacgttcctgagattaaggatcctcactatgtgaagttacacatcaaagctactggtatc
tgtggatcagatgttcactactacactcagggtgctattggtcagtttgttgtcaagagt
cctatggttcttggccatgaatccagtggtatagtggcagaggttggctctgcggtgaca
aacgtcaaggttggtgatagagtagccattgaacctggtatccccagcagatactctgat
gaaaccatgtctggtaactataacttgtgtccgcacatggtcttcgcagctacacctccc
tatgatggtacgttgaccaaatactatttggcacctgaagatttcgtttacaaaatgcca
gaccacttatcgtttgaagaaggtgctcttgccgaacctatgtctgttggtgttcatgca
aacaagcttgctggtaccagattcggtagtaaggtgctggtctctggtgctggtcctgta
ggtctattagcaggtgctgtcgccagagcattcggtgctactgaagttgtctttgttgat
atagctgaagagaagttagaaagaagcaaacaatttggtgccactcacactgtttcctct
tcctccgacgaagaacgtttcgtgagcgaagtctcaaaagttcttggtggtgatttacct
aatatcgtgctagaatgttcaggtgctcagcctgccatcagatgcggtgtcaaggcatgc
aaggcaggtggccattacgtccaagttggtatgggcaaagacgacgttaacttccccatc
agtgcagtgggcagtaaagaaattacattccatgggtgtttccgttacaagaagggtgat
tttgcagattccgttgcattgctttcatctggtagaatcaacggtaagcccttgatctcc
cacagatttgcatttgataaagcaccggaggcttacaagtttaatgctgaacacggcaat
gaagtggttaaaaccattatcaccggcccagaataa

DBGET integrated database retrieval system