KEGG   Zygosaccharomyces rouxii: ZYRO0F07766gHelp
Entry
ZYRO0F07766g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
zro  Zygosaccharomyces rouxii
Brite
KEGG Orthology (KO) [BR:zro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zro03400]
    ZYRO0F07766g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ZYRO0F07766g
DNA repair and recombination proteins [BR:zro03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    ZYRO0F07766g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DZR HypA
Motif
Other DBs
NCBI-GeneID: 8205296
NCBI-ProteinID: XP_002497534
UniProt: C5DXU0
LinkDB All DBs
Position
F:627169..631617
Genome map
AA seq 1482 aa AA seqDB search
MSRQEPSSLDFISPVNPDWMHLQLNDYDFYTTRPSSLDTAHGNSLPMNQYSSVPVIRIYG
CLPSGHQAVCHVHGIFPYIFIGYDGKKQDSSTDMNHRCAKLHRLLESKCQEFAGKNEKVP
SGQPLGALSYIANVSVVKAVPFYGFHVGWSLFYKISLLNPGLVNKFSDWIRDGKMFGKRV
ESYETHLPYLLQFSVDFNLFGCSWMDFNQCYFREPLLNPILSLDVLLMNQDLKTILRRFY
HPNSNALCKKDFPRMGNGLLEIDIIPQYIRNIDNLQFTGESHDSSGTSREELSKPYVTST
KNIVRDISMQRKAMSLEPFKDPPSLERYDINDHWQSSDSFASAFKNFTQKLNQNPKNEHF
GDDSSLFTHVNKPHELLSELWPSRPTAIPSAVTESNNEVEDGLIDTLENDYVIVNSSDTE
NDDKGLEENDSPLAEEYQQNHSTVPVPDGEVPAPGGEIPPLSMDVAMTQKMAKKRKFTFT
QTATHSNVKVQKRKPKKIGIRYERNAYRFKNPPVDYSSTLPGLEDLGFPKQDYIDPFFGD
PKDLKSKPYVYAGKRFEIGSTHLSCRIPMTFEEENIVEGKVRSGNVFHSWKYLRRPPEFQ
TVKHETESMRRTKSFISQIERSSFQRKAIIREKNNAPEEKSSIFSPNTLTHFSMEIHVET
EGSKKPDPVRNEVKMVVWCLEKESFPFDLDISHEGILAVVDQTAEPHLANHIVQGAGDVP
VAFYKTEMDMFDALTDLVLFFDTDILSGFEIHDGSWGYIIERCRKHYGIEISEDFSRVNS
NLKNKARDRWGFTHASGIMIAGRHMINVWRSMRSELNLTQYSLENLAFELLDERIPRFSF
QALTQLWRNRQHPSNVKTVINYWMTRVRMNIRLLQKQDYIARIVEQARLTGIDFYSVYYR
GSQYKVESILFRLCKQEDFLSLSPSRKQVKNQRALECVPLVMEPESAFYKSPVVVLDFQS
LYPSIMIAYNLCYSTMVGRVRDLDFKNELGVTKFPFPKNAFNTLEEHTRITANGIVYVKS
SYRNSTLARMLEDLLYTRRLVKKTMSDVGSKNSSLQKLLNRRQLALKLIANVTYGYTSAS
FSGRMPCSDLADTIVQTGREILEKAIEFIEANEKWGAKVIYGDTDSLFIYLPGKCRYEAH
NIGEEMATEVTKRNRSPISLKFEKVYHPSILLSKKRYVGFMYELPSQLQPIFDAKGIETV
RRDGHPAQQKIVKKCIQILFRTKDLSQVKKYVQEQFVKIHQSKVSLQDFCFARGVRLGSY
KSEKTAPPGAVVATRQKEHDHRSRPQYKERVPYVVARGSVGQILRDRCISPEEFLTDETL
ELDSDYYIEKTLVPPLSRLFNIMGVNVAEWAFEVTRNQSSPAHREAKNIEKVILNLSCIN
CGNDTTTKSQLCEKCQMESLQTSGNLLERRNYREREIKTINTVCRICSYRYTQDAGEMGG
QVASLCESHDCPVYFSRVKAAGYINSTVNRRIAEALNSINHW
NT seq 4449 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcaggaaccgtctagtttggattttatatctccagttaatccagattggatg
cacctgcagttaaatgattatgacttttacacgacaagacccagtagtttagacaccgcc
catggtaacagtttaccgatgaatcaatattcctcagtacctgtaattagaatatacgga
tgtctgccctcggggcaccaagcagtgtgtcatgtacatggtatattcccttacattttt
atcggttatgatggcaaaaagcaggattcatccactgatatgaaccacagatgtgccaag
ctacatcgtctactggagtcaaaatgtcaagagtttgcaggaaaaaatgaaaaagttcct
agtgggcagccacttggtgctctcagttatatcgctaatgtttcagtggtgaaggcggtt
cccttctacggtttccatgtaggatggtcattgttctacaaaatttcgctattaaatcca
ggtctagttaataagttttctgattggatcagagatggtaaaatgtttggcaaaagggta
gagtcttacgaaacccatttgccctatttattacaattctcagtggatttcaacctattt
ggttgttcttggatggatttcaaccaatgctatttccgtgaacctctgctgaatccaatt
ttaagcttagatgttttgctaatgaatcaagacttgaaaacaatccttcgaagattttac
catccgaattcaaatgcactgtgtaagaaggatttccccagaatggggaatggtctactt
gaaattgatatcattccacaatatattcgtaacatcgataatttacaattcactggtgaa
tcccacgattcctcagggacttcaagagaagaattgagcaaaccttacgttacctctact
aagaacattgttagagatatctccatgcaaagaaaagccatgtctttggagccctttaag
gatccaccaagtttggaacgttatgacattaatgaccattggcaatcatctgatagcttt
gccagtgctttcaagaattttacgcagaaactgaaccagaacccgaaaaatgaacacttt
ggggatgattcttcgttatttacacacgtcaacaaacctcatgaacttttgtcggaactg
tggccctctaggccaacggctattccgtcggcggttacagaatccaacaatgaggtagag
gatggattaatcgacactttggaaaatgattacgtcatagtcaactctagtgatacagaa
aatgatgacaagggtttagaggagaacgattctccgcttgctgaagaatatcaacaaaat
catagtacggtgccagttccggatggagaggtacctgctccgggtggagagataccaccg
ctgtcaatggatgtggcgatgacccaaaagatggctaaaaaacggaaattcactttcact
caaactgctacacattcaaatgtcaaagtacagaaaagaaagcccaagaaaattggtatc
agatatgaaagaaacgcttacaggtttaaaaatcccccagttgattattcttccactttg
cccggtctagaagatttaggattccccaagcaagattacatagatccgttctttggagat
ccaaaggatttaaagtcaaaaccatacgtctatgctgggaaaagatttgaaattggctcc
acccatttaagttgcagaatacccatgacctttgaggaagaaaatatagtagaaggtaaa
gtgagaagtggaaatgtctttcattcctggaaatacttaagacgaccgcccgaatttcaa
acggtaaaacatgagactgaatccatgagaaggaccaaatcatttatttcacaaatcgaa
cgatcatcgtttcagagaaaagctataatcagggaaaaaaacaatgcacccgaggagaag
agtagtatcttttctccgaatactttgactcactttagtatggagatccacgtagagact
gaaggatctaaaaagcctgaccctgtcaggaatgaagttaaaatggttgtgtggtgttta
gaaaaggaatcctttccctttgatttagacatctctcatgaaggcattctcgctgtagta
gatcaaaccgctgaacctcatttggcaaatcatatcgtccaaggtgctggtgatgtacca
gtagcattttacaaaacagaaatggatatgtttgatgcattgacagatctagttctcttt
tttgatacagatatcctatcaggttttgaaattcatgacggatcatggggttatataatc
gagagatgcagaaagcactatggaattgagatatccgaagacttttcaagagtcaattcc
aacttgaagaataaggcacgagatagatggggcttcactcatgcatcagggataatgatt
gccggaagacatatgataaatgtgtggagaagcatgagatcagagttgaacttaacgcag
tacagcttggaaaatttagcgtttgaactgttagatgaacggataccccgtttctcattc
caagcactcactcaattatggaggaaccgccaacacccttcgaacgtaaaaacagtaatc
aattattggatgacacgcgtaagaatgaatataagacttctacagaaacaagattacatc
gccagaatagtagagcaggcgaggttgacaggaattgatttttactcagtctattataga
ggatcacaatacaaagtcgagtcaattcttttccgtctttgcaagcaggaagattttctt
tcattatctcccagtagaaaacaggtcaaaaaccagcgagcactggaatgcgttcctttg
gtcatggaacccgaatctgccttctacaaaagtcctgttgtagtcctggatttccaatca
ctgtatccttcgattatgatagcctataacctttgctactctacaatggttggaagggtc
agagatttagatttcaagaatgagcttggtgtaaccaaattcccctttcccaaaaatgca
tttaataccttagaagagcacacgaggataactgccaacggaatagtatatgtgaagtca
tcttaccgtaactccactttggctaggatgttagaggaccttttatatacaaggaggttg
gttaaaaaaaccatgagcgatgtggggtcgaaaaattcttccttgcagaaactacttaat
cgccgacaactagcgctaaagttgatagctaacgtaacctatgggtatacatcagcatct
ttttcaggtagaatgccatgctcagatttagccgacaccatcgtacaaaccggaagagag
attttagagaaggcaattgaatttatcgaagccaatgaaaaatggggggctaaagtaata
tatggcgatactgacagtcttttcatatatttaccgggaaaatgtcgatacgaagcccat
aatattggtgaagagatggcaacagaagtgaccaaacgcaatcgatcccccatatcgctt
aagttcgagaaagtttatcatcctagcatactacttagtaaaaaaagatacgtcgggttc
atgtacgaattaccttcgcaactacaaccaatcttcgatgcaaagggtattgagacggta
agaagagatggccatcctgctcagcaaaagattgttaagaaatgcatccaaatccttttt
cgaaccaaggacttatctcaagtgaaaaaatatgtacaggaacaattcgtcaagatccat
caaagcaaagtgtccttacaagatttttgttttgccagaggggtacgtttaggttcttat
aagagtgagaagacagctccacctggtgcagtggtagcgacaagacagaaagaacatgat
cataggtctagaccacagtataaggaacgggttccatatgtggtagctcgaggctcagta
ggccaaatattaagggacagatgtatctccccagaggagtttttaacagacgaaactttg
gagctcgattcagattactacatcgaaaagactctagtaccgccgctatcccgacttttt
aatatcatgggagtaaatgttgctgagtgggcttttgaagtcactagaaatcaatcttcc
ccagcccacagagaagcaaaaaatattgaaaaggtgatattaaatttatcatgtattaac
tgtggtaatgacactacaacgaaatcccagctatgtgaaaaatgtcagatggaatcccta
caaacgtcagggaatcttctagagagaagaaattacagagaaagagaaatcaagacgatt
aatactgtctgcagaatctgttcctaccgctatactcaagatgcaggtgagatgggaggt
caggtagcatcgctatgcgaatcacatgactgtcctgtctatttcagtagagtaaaagcc
gctggatatatcaattctacagtcaacagaagaattgcggaagctttaaattcaattaac
cattggtga

DBGET integrated database retrieval system