KEGG   Zygosaccharomyces rouxii: ZYRO0F11572gHelp
Entry
ZYRO0F11572g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro03030  DNA replication
zro03410  Base excision repair
zro03420  Nucleotide excision repair
zro03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:zro00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ZYRO0F11572g
   03410 Base excision repair
    ZYRO0F11572g
   03420 Nucleotide excision repair
    ZYRO0F11572g
   03430 Mismatch repair
    ZYRO0F11572g
Enzymes [BR:zro01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ZYRO0F11572g
    6.5.1.6  DNA ligase (ATP or NAD+)
     ZYRO0F11572g
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ZYRO0F11572g
DNA replication proteins [BR:zro03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ZYRO0F11572g
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ZYRO0F11572g
DNA repair and recombination proteins [BR:zro03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ZYRO0F11572g
   NER (nucleotide excision repair)
    Other NER factors
     ZYRO0F11572g
   MMR (mismatch exicision repair)
    Other MMR factors
     ZYRO0F11572g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Phasin
Motif
Other DBs
NCBI-GeneID: 8205468
NCBI-ProteinID: XP_002497702
UniProt: C5DYA8
LinkDB All DBs
Position
F:949236..951431
Genome map
AA seq 731 aa AA seqDB search
MLARVHQLSVIGVRRFGMATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTT
NVKRESPVRSNSNEKESSPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNN
QDDHFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLG
PDYEPGMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKP
LTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKT
VLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKH
CQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNG
ENMTERYPEIDIRDFLSDPSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVK
VRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLD
QSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKR
TGTYGGFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQ
PDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQV
VDLYEAQAHLS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccagggtacatcaactctctgtcatcggtgtaagacgttttggaatggctact
tcatcatctcaacccaagaaacaggcaaaacaagctactttggccaagtttttctcttct
gtcaaagatagaaactcacccaccaagaaaaatgccacacctgcttttcctactactacc
aatgtgaagcgcgaatcacctgtaagatccaattctaatgaaaaggagagtagcccgatg
ttcgatgattctaacggtagatctagcgcatgttctagcgcaggattggaaatggaatcg
gcacctgctcctaaaaaattaaagatggaatccgattccaattccacttctaagaataat
caggatgaccatttctctacagtgccctatgcagatgtttgtaacatttttcaagagatt
gaatcaacatcatcacgtctgtcgatcatcaaaatatgttcagatttctttacccagatt
gtgaaggaagattccaggaatttagtgcccaccacctatctattcatcaataaattgggt
cctgattatgaacctgggatggaattgggtcttggtgaaggacttttaatgaagactatc
agtgaatcatgtggtaaatcattagcgcaggttaaaaatcgttatagagaaatgggggat
ttaggacagatcgccatggaggcacgtaatgttcagccaacaatgttcaaaccaaaaccc
ttgaccgtgggggaagtctttgtcaacttgagaaatatcgctaatgcacagggtaaggat
tctcaaaataaaaagataaaattgattaaaaggatgctaactgcctgccaaggtgttgaa
gctaaatttcttattagatctttagaatctaagttgagaattggtctggcggagaaaaca
gttctcatttcgttgtcgaatgccttgttaagacacgaacaaggtcttgacgtggaaccg
tccgacgaagccgttgacaaggcggaacaaagcattagagatgccttttgtcaagttccc
aactacgagattgtaataaacacttgtttagagcacggaatttctcaattgcacaaacac
tgccaattgacccccggtataccgctgaaaccgatgttggctaaacctacaaaggctatc
accgaagttctggacagatttcaaggccaattgttcgtatctgaatacaagtacgatggt
gaaagagcccaattacatttactacctgacggtaccatgcgtatttattctcgtaacggt
gaaaatatgaccgagaggtatccagaaatcgatatccgtgattttctatcggaccctagc
acggaatctttgattttagattgtgaagctgttgcctgggacaaagaacaaggcaaaatc
ctaccattccaagtcttaagcacacgtaagcgcaaggatgtagatgctaaggatgtcaaa
gtacgtgtctgtctatttgcatttgatctgctgtgccataacggcgaacccttgattaat
aaatctttgcgcgagcgtcaagacgatctgcaaaaagtgaccaaacctgtagatggtgaa
tttcgatatgccaacaagctcattacagcaaacatagaggagcttcagcacttcctagat
caatctgttaaggactcatgcgaagggctcatggttaagatgttagatggtccggaatct
cattacgagcccagcaagcggtctcggaactggctgaaattgaagaaagactatttgaac
ggtgtaggagactctcttgatctatgtgttttaggagcttattacggtagaggtaagcgt
acaggtacctatggtggattcttactagggtgctacaaccaagatacaggtgagtacgag
acttgttgtaaaataggtactggtttttcagaggaattacttcaacaattatacgatagg
ttaaagccaactgccatggaagcgcctgctgcattctacgtttatgactcagctcaacaa
ccagacgtatggttcgaacccacattacttttcgaggtgctagctgccgacctgtctcta
tcgccggtgtacaaggcaggttctgcccagtatgataagggaatttcgttgaggttccca
cggttcctgagaataagagatgacaagtctgtcgaggaggcaacatcctccgagcaagta
gttgatctatatgaggctcaagctcacttatcctga

DBGET integrated database retrieval system