KEGG   Zymoseptoria tritici: MYCGRDRAFT_100586Help
Entry
MYCGRDRAFT_100586 CDS       T02285                                 

Gene name
HKX1
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00010  Glycolysis / Gluconeogenesis
ztr00051  Fructose and mannose metabolism
ztr00052  Galactose metabolism
ztr00500  Starch and sucrose metabolism
ztr00520  Amino sugar and nucleotide sugar metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
ztr01200  Carbon metabolism
Module
ztr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ztr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCGRDRAFT_100586 (HKX1)
   00051 Fructose and mannose metabolism
    MYCGRDRAFT_100586 (HKX1)
   00052 Galactose metabolism
    MYCGRDRAFT_100586 (HKX1)
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_100586 (HKX1)
   00520 Amino sugar and nucleotide sugar metabolism
    MYCGRDRAFT_100586 (HKX1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MYCGRDRAFT_100586 (HKX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ztr04131]
    MYCGRDRAFT_100586 (HKX1)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MYCGRDRAFT_100586 (HKX1)
Membrane trafficking [BR:ztr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MYCGRDRAFT_100586 (HKX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 13401743
NCBI-ProteinID: XP_003851743
JGI: Mycgr3_100586
UniProt: F9XDZ5
LinkDB All DBs
Position
6
AA seq 496 aa AA seqDB search
MVGLGPRRKPSRKGSMADMPQDLLSEIKRLEELFIVDTPKLKSITEHFISELAKGLTKEG
GSIPMNPTWVMGYPTGHETGTFLALDMGGTNLRVCEINLPEEKGEFDIIQSKYRMPEELK
TGNADELWGYIADCLQQFIEYHHEGEKLDKLPLGFTFSYPATQDFIDHGVLQRWTKGFDI
DGVEGKDVVPPFEAALQERGVPIKLTALINDTTGTLIASSYTDPEMKIGCIFGTGCNAAY
MEHAGEIPKLEDWKMDPKQEIAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEK
MIAGLYLGELFRLVLVDLHEKNVVFQGQDIAALRKPYSLDASYLSDIENDPFENLQETAD
NFKSVLNITTSKPELELIRRLAELIGTRSARLSACGVAAICKKKGYKTAHVGADGSVFNK
YPHFKQRGAAALKEILDWETGRDGKPLGKGNDPVEIMPAEDGSGVGAALIAALTLKRAKE
GKLEGIRDAESMLKGM
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcctcggaccacggcgcaagcccagccgcaagggctccatggcagacatgcca
caggacttgctttcggagatcaagcgcttggaagagttgttcatcgtggacaccccaaag
ctcaagagcatcaccgagcacttcatctcggagctggccaagggcctcacaaaggagggc
ggcagcatcccaatgaacccgacctgggtcatgggctacccgactggacacgagactggc
actttcctcgcactcgacatgggcggtaccaacttgcgcgtctgtgagatcaacctgcca
gaggagaagggcgagttcgacatcatccagtccaagtaccgcatgccagaggagctcaag
accggcaacgccgatgagctttggggatacatcgccgactgtctgcaacaattcatcgag
taccaccacgagggtgagaagttggacaagctcccactcggcttcaccttctcctaccca
gcgacacaggacttcatcgatcacggtgtgctgcagcgctggaccaagggtttcgacatt
gatggtgtcgagggcaaggatgtcgttccgccattcgaggctgcgctacaggaacgtggc
gtcccaatcaaattgactgcactcatcaacgacaccaccggtaccctcattgctagcagc
tacacggatccggagatgaagattggatgcattttcggtactggctgcaacgctgcgtac
atggagcacgctggtgagattccaaagctcgaggactggaaaatggacccgaagcaggag
atcgccattaactgcgaatggggtgcctttgacaacgagcacaaggttctcccgcgcaca
ccatacgacatcatcatcgacaaggactcgcctcgtcctggtcagcaagctttcgagaag
atgatcgctggtctctatcttggtgagctattccgtttggtgcttgtcgatctccacgag
aagaacgtcgttttccagggccaggacatcgccgcgcttcgcaagccctactcgctcgat
gcctcatacctctccgacatcgagaacgatcctttcgagaacttgcaggagaccgccgac
aacttcaaatccgttctcaacatcaccaccagcaagcctgagctcgagttgataagacga
ctggctgagctcatcggcacgcggtcggcgaggttgagcgcatgtggtgtggcggcgatc
tgcaagaagaagggatacaagactgctcacgtcggtgctgatggttcggtgtttaacaag
taccctcacttcaagcaacgcggagcagctgctctgaaggagattctcgactgggagact
ggccgtgacggcaagccgctcggcaagggcaacgacccggtggagatcatgccggctgag
gatggttctggtgttggcgcagccctcatcgccgctcttacgctcaagcgcgccaaggag
ggcaagctcgagggtatccgtgatgccgagtccatgctcaagggtatgtga

DBGET integrated database retrieval system