KEGG   Zymoseptoria tritici: MYCGRDRAFT_101535Help
Entry
MYCGRDRAFT_101535 CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr03030  DNA replication
ztr03410  Base excision repair
ztr03420  Nucleotide excision repair
ztr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MYCGRDRAFT_101535
   03410 Base excision repair
    MYCGRDRAFT_101535
   03420 Nucleotide excision repair
    MYCGRDRAFT_101535
   03430 Mismatch repair
    MYCGRDRAFT_101535
Enzymes [BR:ztr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MYCGRDRAFT_101535
    6.5.1.6  DNA ligase (ATP or NAD+)
     MYCGRDRAFT_101535
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MYCGRDRAFT_101535
DNA replication proteins [BR:ztr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MYCGRDRAFT_101535
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MYCGRDRAFT_101535
DNA repair and recombination proteins [BR:ztr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MYCGRDRAFT_101535
   NER (nucleotide excision repair)
    Other NER factors
     MYCGRDRAFT_101535
   MMR (mismatch exicision repair)
    Other MMR factors
     MYCGRDRAFT_101535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase TonB_N
Motif
Other DBs
NCBI-GeneID: 13396322
NCBI-ProteinID: XP_003848305
JGI: Mycgr3_101535
UniProt: F9XMN5
LinkDB All DBs
Position
11
AA seq 854 aa AA seqDB search
MSTPNKRRKKNDHNPSPLPARSLEHFFGRQTAKAKDPQDESVVNDTKIEERLRDAETPAE
HVPGGGADLTDEQLARKLQAEWDEEDKRQPASEEAIKDEVREGDKISDVLAPSEEDNTRP
TAPTNAFVAMGKKGTLSLQSATADQDTISHDIPFDESPLTFDPENTQSRIKIVDTLVNLI
RVLIVGDPESLLPAVWLATNSISPPYIDVELGLGGSAISKALKKVCGLDNSSLKTLYNKH
GDAGDVAFEAKKRQSFTLRKPKPLTIKGVFDGLFKIASAKGQGSQEVKQRIVERLVQDAR
GAEESRYIVRTLVQHLRIGAVKTTMLIALSRAFLLSRPPGTDFAIKSQSELRKLSKQELA
EVYSQGEELVKASFARRPNYNDLVPTLLEIGIDDELLLRCGLAMHIPLRPMLGGITRDLG
EMLTKLHGRDFSCEFKYDGQRAQVHCDENGKVTIFSRHLEVMTDKYPDLVALVPQIRGEG
VSSFILEGEVVAVDRESGDLKPFQILANRARKDVVIQSVKVDVCLFSFDLMYLNGEELLD
RSFRERRSLLRSLFVEIPNHFSWVKSMDATSADFDEVSAFFKQATDIKCEGIMVKVLDNL
PNPELEADIEGEAPEGEPEPKPIPTSKGKKSKKAKSKAANSTSTIDTEEKKGSRRKALLA
TYEPDKRLDSWLKVKKDYNSLTDTLDLIPVGAWHGQGRKNAWWSPILLACRNPATGSLEV
VTKCISGFTDAFYKANRAKYDPDVDEDDEEGRSSNCIPRPAYVDYAGEPDVWFEPQEVWE
MVFADITLSPTYTAAIGLVSEERGLSLRFPRFLKVREDKSIEEASTSDFLASLYRKQEAK
APGKVEAMDEDEEE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgccgaacaagcggcgcaagaagaacgatcacaatccttcgccgcttccagct
cgcagtctcgagcacttcttcgggaggcagacggcgaaggcgaaagatccgcaggatgag
agtgttgtgaacgacacgaagatcgaggaaaggctgcgggatgcagagacacccgcggag
cacgtcccgggcggaggtgccgatctgacggatgaacagctcgcgaggaagctccaggcc
gagtgggatgaggaggacaaaaggcagcctgcgagcgaggaagcaatcaaagatgaagtg
cgagagggcgacaaaatcagtgatgtgctggcaccatcggaagaggacaacacaagaccg
acagcaccaaccaatgccttcgttgcaatgggcaagaaaggcacactgtctctgcagtca
gcaaccgctgatcaagacaccatctcccacgacattccgttcgacgagtcaccgctcaca
ttcgacccggagaatacgcagtcgaggatcaagatagtggatactctggtaaatctcatc
cgagtcttgatcgttggcgatcccgaatctcttctcccggccgtctggctagccacaaat
tccatttcgcctccctatatcgatgtagagctcggactcggagggtccgcgatttcaaaa
gcgctcaaaaaggtctgcgggctggacaactcgtcactcaagacgttgtacaacaagcat
ggcgatgcaggggatgttgcgttcgaggccaagaagaggcagagcttcactctgcggaag
ccaaagccgctgacgatcaaaggagtgttcgatggtctgttcaagattgcaagcgccaaa
ggtcaaggcagccaggaggtcaagcagcgcatagtcgaacgactggttcaggatgcaaga
ggtgccgaggagagcagatacattgttcgcacgctcgtgcagcatctcagaatcggcgcc
gttaagacaacaatgctaatcgcattatcgagagcatttctgctgtctcgtccgccaggc
accgacttcgcgatcaaatcgcaatccgagctgcgaaagctgagcaaacaagagctggca
gaggtctactcgcagggtgaagagctagtaaaagccagcttcgctcgccgaccgaattac
aacgatcttgttccgacccttctcgagattggtatcgacgacgaattattgctccgctgc
ggtctggctatgcacatccccttaaggcccatgctaggagggattacgcgagatttgggc
gagatgctgacgaaattgcatggtcgggatttttcctgcgagttcaaatacgacggccaa
cgagcgcaagtccactgcgatgagaatggcaaagtcacgatattctctcgccatttggaa
gtcatgacggacaagtatcctgatctggtcgcactggttccacagattcgtggcgaagga
gtcagcagcttcatcttggagggagaggtcgtagctgtcgatcgtgagtctggtgatctg
aaacctttccagatcctcgccaatcgagcgaggaaggatgtggtcattcaaagcgtcaag
gtcgatgtatgtctcttctcattcgacctcatgtatctcaacggcgaggagctcttagat
cggtccttccgagaacggcgtagcttactccgcagccttttcgtcgagatacccaatcat
ttttcgtgggtcaaatcgatggacgcgacgtccgctgatttcgacgaggtcagcgccttc
ttcaagcaagcgacagacatcaagtgcgagggcattatggtcaaggtgctcgacaacttg
cccaatcccgagctcgaagccgacattgagggggaagcgcctgaaggggagccggagcca
aagccaatacccacttccaagggaaagaagtcgaagaaggccaagagcaaggcagccaat
agcacatccacgatcgataccgaggagaagaagggctctcgccggaaggcccttctcgcg
acctacgaacccgacaaacgtctcgactcatggctaaaagtgaagaaagattacaatagc
ctcaccgatacccttgatctaatccccgtcggcgcctggcacggtcaaggccggaagaac
gcctggtggtcaccgattctcctcgcctgccgcaatcctgccacaggaagtctcgaagtc
gtgacgaaatgcatatctggtttcacggatgcattctacaaagccaatcgcgcaaagtac
gatccggacgtcgacgaggatgatgaggaagggcgatcgtcgaattgtattcctcgcccg
gcgtatgtggattacgcgggtgagccggacgtgtggtttgagccgcaggaggtgtgggag
atggtgttcgccgacattaccttgagcccgacgtacacggcggcgataggacttgtcagc
gaggaaaggggcttgagcctgaggttcccaagatttctgaaggtcagagaagataagagt
atcgaggaggcgagtacaagtgacttcctggcgagtctgtataggaagcaggaggcgaag
gcacctgggaaggtggaggcgatggacgaggacgaagaggaatga

DBGET integrated database retrieval system