KEGG   Zymoseptoria tritici: MYCGRDRAFT_103593Help
Entry
MYCGRDRAFT_103593 CDS       T02285                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MYCGRDRAFT_103593
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MYCGRDRAFT_103593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 13395761
NCBI-ProteinID: XP_003853688
JGI: Mycgr3_103593
UniProt: F9X7L5
LinkDB All DBs
Position
3
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSNVKGTVTFEQTSEGAETTITWDITGNDPNAERGMHVHAFGDNTNGCTS
AGPHFNPHSKTHGAPEDSERHVGDLGNFKTDGQGNGKGSVTDKLIKLIGPESVLGRTVVV
HGGTDDLGKGGHEESKKTGNAGPRPACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcagtcgctgttctccgtggagactccaatgtcaagggcaccgtgaccttc
gagcagacctccgagggcgccgagaccaccatcacatgggacatcaccggcaacgacccc
aacgccgagcgcggcatgcacgttcacgcctttggtgacaacacgaacggctgcaccagc
gctggtcctcacttcaaccctcactccaagacccacggtgcccccgaggactccgagcgc
cacgtcggcgacttgggcaactttaagaccgacggccagggcaacggcaagggcagcgtc
acggacaagctcatcaagctgatcggacccgagagcgtgctcggtcgcactgtcgtcgtc
cacggcggcaccgatgatctcggcaagggaggtcacgaggagagtaagaagacgggtaac
gctggaccaaggccggcttgcggtgtcattggcatcgctgcttaa

DBGET integrated database retrieval system