KEGG   Zymoseptoria tritici: MYCGRDRAFT_107709Help
Entry
MYCGRDRAFT_107709 CDS       T02285                                 

Gene name
SDG2411
Definition
(RefSeq) SET domain-containing protein
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    MYCGRDRAFT_107709 (SDG2411)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ztr03036]
    MYCGRDRAFT_107709 (SDG2411)
Enzymes [BR:ztr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MYCGRDRAFT_107709 (SDG2411)
Chromosome and associated proteins [BR:ztr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MYCGRDRAFT_107709 (SDG2411)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    MYCGRDRAFT_107709 (SDG2411)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 13398574
NCBI-ProteinID: XP_003856939
JGI: Mycgr3_107709
UniProt: F9X0Q5
LinkDB All DBs
Position
1
AA seq 529 aa AA seqDB search
MATPKVTKPPTRANFVIDPSKITGILTHRQVRAGEEYLILHRTTGPASAEVASWHTVPEL
RRCLYLVQEYLDTLPPRSEDHRSLLGAQSRKRKSPHDELSANGTPNGFQSPFHTNGIGSP
SPSPSSSSSSSSETGPRVFNGSLSKRAGFLLAQRSSRHGTPVNATRLPTPAMLEAALKTA
TPESERAIRDAFVEKLKSLRGVTLENDVDSSTPSLNFTFIKEYVLREGVSAQDPSMFEGC
TKCKPDMGQNVGCEYTQKCGCLEYAAVDEQALQSRNPEMYEEYLRVKENQGFQRPDLPKR
FPYTKPSIGDTVPQRLVTYYRDHRHAVYECNDNCACGPRCKSRLVQKGRRVPLIIFKTPD
RGWAVKCGIALQQGQFIDTYLGEVITSEETDRREENAGQEKASYLYSLDKFVGDPVPGEG
TVLTSDDCYVIDGQHWGNVTRFINHSCDPNCRQYTVSYDKNNILLYNLAFFAYTDIPAGT
ELTFDYMDKDEMEVEDAILYREQILSDPANQDRVRCNCGSVKCRGVMWV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccgaaggtcaccaaaccaccgacacgtgccaatttcgtgatcgacccaagc
aagatcactgggatcttaactcatcgacaagtccgagcgggggaagaatatctgatactt
caccgcacaactggacctgcatcggcagaagtcgcgtcatggcacactgttccggaactt
cgacgctgtctatatctcgtgcaagagtatctcgacaccctgccaccgcgaagtgaagac
catcggagcctccttggcgctcagagccgcaagcgcaagtcgccgcacgacgagctaagc
gcgaacggaacaccaaatggctttcagtctcccttccataccaatggcatcggctcgcca
tcaccatcgccaagctcctcttcctcatcctcgtctgagactggaccccgcgtgtttaac
ggctcactctctaagcgagctggattcctacttgcacagagatcaagtcggcatggaact
cctgtcaatgcaactcgactgccaactccggctatgctggaggcggctttaaagacagcg
acacccgagagtgagcgtgcgatccgggatgcctttgtcgaaaagctgaagtcgcttcgg
ggcgtgactctggagaatgatgtcgactcttccacgccttcgctcaacttcactttcatc
aaggagtacgtgctgcgcgaaggcgttagtgcgcaagatcccagtatgtttgagggatgc
accaaatgcaagcccgacatgggacaaaatgtaggctgcgagtacacccaaaagtgcggc
tgcttggagtacgccgcagtcgacgaacaagccttgcaatccaggaaccccgagatgtac
gaggagtaccttcgagtgaaggagaaccagggatttcagcggcctgatttgccaaaacgg
ttcccctacacgaagccgagcataggcgacacggtaccccaaagactggtcacatactac
cgggaccaccggcatgccgtgtacgagtgcaatgacaactgtgcctgtggaccgagatgc
aagagtcgactggtccagaaaggacggcgagtgcctctcatcatcttcaagactccggat
cgaggttgggcggtgaaatgcggcattgctctgcagcaaggccagttcatcgatacatat
ctcggggaggttattacaagcgaggagacggatcgtcgagaagaaaacgctggccaggag
aaggcatcatatctctactccctggacaagttcgttggtgatcccgtcccaggtgaagga
actgtgctcacatccgatgattgctacgttatcgacgggcagcactggggaaatgtcaca
cgcttcatcaaccacagctgcgacccgaactgccgacaatacactgtttcgtacgacaag
aacaacatcttgttgtacaacctggcgttcttcgcatacactgacatcccagctggaacg
gagctgacctttgactacatggataaggatgagatggaagtggaagatgcgatcctgtac
cgggaacagatattgagtgatccagcgaaccaggatcgtgtacggtgcaactgtggctct
gtcaagtgcagaggggtgatgtgggtttga

DBGET integrated database retrieval system