KEGG   Zymoseptoria tritici: MYCGRDRAFT_33235
Entry
MYCGRDRAFT_33235  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00480  Glutathione metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCGRDRAFT_33235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ztr02000]
    MYCGRDRAFT_33235
Enzymes [BR:ztr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYCGRDRAFT_33235
Transporters [BR:ztr02000]
 Other transporters
  Pores ion channels [TC:1]
   MYCGRDRAFT_33235
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5
Other DBs
NCBI-GeneID: 13403009
NCBI-ProteinID: XP_003856211
JGI: Mycgr3_33235
UniProt: F9WWE7
LinkDB
Position
1
AA seq 274 aa
MSTNGNSNKALDPNQGGDATKKTYHKQPTGEAKKTADAHSKENELKLYGSCFCPFVHRVW
ISLELKGLDYEYVEVDVYRKPKLLLDINPRGLVPALRHGDWGMYESTVVMEYLEDLNEGK
ALLPRDPKLRAHSRLWVDHINRHIIPAFYKYLQAQEPADQVKFAGELKDHISKAVDAADE
EGPFFLGSEMGFVDVQLAPWVVRLEKVLKPYRGWPSPEPGSRWEKWVNAIEQSEPVKRTT
SNDELYLDSYERYAENRPNTSQVRDAINSGGGLP
NT seq 825 nt   +upstreamnt  +downstreamnt
atgtcaaccaacggcaattccaacaaggcgcttgatccaaaccagggaggggatgcaacg
aagaagacctaccacaagcagccgactggagaagcgaagaagactgccgatgcacattcc
aaagagaacgagttgaagctgtatgggagttgcttctgcccattcgtccaccgagtctgg
atttcgcttgaactcaagggcttggactatgaatatgtcgaggtggacgtgtatcgcaag
ccaaagctgcttctcgacattaatcctcgtggacttgttcccgctcttcgccacggagac
tgggggatgtacgaatccactgttgtcatggaatacctggaagatttgaacgaaggaaaa
gcactcctgccaagagacccaaaactacgcgcccattctcggctgtgggtggaccatatc
aaccgtcatatcatcccagctttctacaaatacctacaggcccaagagcccgccgatcaa
gtcaaatttgcaggggagctgaaggaccacatatcgaaagcagtcgatgccgctgatgag
gaaggcccattctttctgggctctgagatgggtttcgtcgacgtgcagttggcaccgtgg
gttgtgcgacttgagaaggtgttgaagccatacagaggctggccatcgcccgagccaggc
agccgatgggagaagtgggtcaacgcgattgaacagagcgagccagtgaagagaacgacc
agcaatgatgaattgtacctggacagctatgagcgttacgcggagaatagacccaacacg
tcccaggtacgagatgccatcaactcgggaggtgggctgccttga

DBGET integrated database retrieval system