KEGG   Zymoseptoria tritici: MYCGRDRAFT_33235Help
Entry
MYCGRDRAFT_33235  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
Organism
ztr  Zymoseptoria tritici
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 13403009
NCBI-ProteinID: XP_003856211
JGI: Mycgr3_33235
UniProt: F9WWE7
LinkDB All DBs
Position
1
AA seq 274 aa AA seqDB search
MSTNGNSNKALDPNQGGDATKKTYHKQPTGEAKKTADAHSKENELKLYGSCFCPFVHRVW
ISLELKGLDYEYVEVDVYRKPKLLLDINPRGLVPALRHGDWGMYESTVVMEYLEDLNEGK
ALLPRDPKLRAHSRLWVDHINRHIIPAFYKYLQAQEPADQVKFAGELKDHISKAVDAADE
EGPFFLGSEMGFVDVQLAPWVVRLEKVLKPYRGWPSPEPGSRWEKWVNAIEQSEPVKRTT
SNDELYLDSYERYAENRPNTSQVRDAINSGGGLP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccaacggcaattccaacaaggcgcttgatccaaaccagggaggggatgcaacg
aagaagacctaccacaagcagccgactggagaagcgaagaagactgccgatgcacattcc
aaagagaacgagttgaagctgtatgggagttgcttctgcccattcgtccaccgagtctgg
atttcgcttgaactcaagggcttggactatgaatatgtcgaggtggacgtgtatcgcaag
ccaaagctgcttctcgacattaatcctcgtggacttgttcccgctcttcgccacggagac
tgggggatgtacgaatccactgttgtcatggaatacctggaagatttgaacgaaggaaaa
gcactcctgccaagagacccaaaactacgcgcccattctcggctgtgggtggaccatatc
aaccgtcatatcatcccagctttctacaaatacctacaggcccaagagcccgccgatcaa
gtcaaatttgcaggggagctgaaggaccacatatcgaaagcagtcgatgccgctgatgag
gaaggcccattctttctgggctctgagatgggtttcgtcgacgtgcagttggcaccgtgg
gttgtgcgacttgagaaggtgttgaagccatacagaggctggccatcgcccgagccaggc
agccgatgggagaagtgggtcaacgcgattgaacagagcgagccagtgaagagaacgacc
agcaatgatgaattgtacctggacagctatgagcgttacgcggagaatagacccaacacg
tcccaggtacgagatgccatcaactcgggaggtgggctgccttga

DBGET integrated database retrieval system