KEGG   Zymoseptoria tritici: MYCGRDRAFT_33425Help
Entry
MYCGRDRAFT_33425  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00730  Thiamine metabolism
ztr00790  Folate biosynthesis
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MYCGRDRAFT_33425
   00790 Folate biosynthesis
    MYCGRDRAFT_33425
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MYCGRDRAFT_33425
Exosome [BR:ztr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCGRDRAFT_33425
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ztr00537]
 Enzymes
  MYCGRDRAFT_33425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 13403860
NCBI-ProteinID: XP_003855921
JGI: Mycgr3_33425
UniProt: F9WYR5
LinkDB All DBs
Position
1
AA seq 617 aa AA seqDB search
MPSTGQDAPVLHRPTSPSNSSNIEEEDALLTGQRTGKSEPSPTTHNRNKWREIGLFVWAV
VASAVVIVLAVFYQHNAQGGDTDGRSGHGGHGGHGGHAGKAPIVAGKRNLIFMVSDGMGP
TSLELTRSWRQYTDHLPWNETLELDKHLIGQSRTRSSSSLVTDSAAGATAFSCGAKSFNG
AISVLPDFSPCGSVMEAAKRMGYTTGLVVTTRITDATPAVFASHVRRREMEDEIALQMVG
ETHPLGRMVDLMMGGGRCHFLPQGNEGSCREDEVDVVKAAKEKGGWKYIDDKAGFDRLDG
GKKVELPLLALFAPGDIPYEVDRRFQQDIYPSLENMTRTALRALADATKHSDQGFFIMIE
GSRIDHAGHANDPAAQVHEVLAYDHAISAVLDFIEHSDVPTVMVSTSDHETGGLAAARQL
HSPTYPEYLWYPSVLAAANHSASYTSHEFSAHHSAAPNEKPEQFAAFVKDLVSRDLGISD
LSSDEVKSLQDTPNLAPYIFADVLSRRAQTGWSTHGHSGADVNIYSSSPDAAAALQGNHE
NTEVGGFLRDYLGLGEEVEKVTRLLREHAKGKAEEEVWLGSVPEEGERLDGQSHREDGYH
GEHRTRAEKRVCAVCGV
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgccctccacagggcaagacgctcccgtccttcaccgtccaaccagcccttcgaactcc
tccaacatcgaagaagaagacgccctgctcacaggccagcgaacggggaagagtgagccc
agcccgacgacacataacaggaacaaatggcgggagataggactctttgtttgggcggtt
gtggcgagtgctgttgtgattgtgttggcggttttctaccaacataatgcgcagggaggg
gatacggatggacggagtggacatgggggacatggaggtcatggaggtcatgctggaaag
gctcctatcgtcgccgggaagaggaatctaatcttcatggtcagcgatggaatgggaccc
acaagcctcgagctcacgcggagttggagacaatatacggatcatttaccctggaacgag
acgctcgaactggataaacaccttatcggacagtcgcggacacggagttcaagctcgctg
gtcaccgactccgcggcgggagccacagctttctcctgcggcgcaaaatccttcaatggc
gccatctccgtgctcccagacttcagtccctgtggaagcgtcatggaagccgcgaagagg
atggggtatacgacgggtttggtggtcacgactaggatcacggatgccacgcctgcggtg
tttgcgagccatgtgaggaggagagagatggaagatgagattgcgttgcagatggttggg
gagacgcatccgttgggaaggatggtggatctcatgatgggtggagggaggtgccatttc
ttgccgcaggggaacgaggggagttgcagagaggatgaggtggatgtggtgaaagcggcg
aaggagaagggagggtggaagtatattgatgacaaggctggattcgatcgtctggatggc
gggaaaaaagtggaacttccactcctcgcactcttcgcaccaggcgatatcccctacgaa
gtcgaccgccgctttcaacaggatatctacccatccctggagaacatgacccgcaccgcc
ctccgtgctctcgccgacgccacaaaacactccgaccaaggcttcttcatcatgatcgaa
ggctcccgcatcgaccacgccggccacgccaacgacccggcggctcaagtccacgaggtg
ctagcctacgaccacgccatctcggccgtgctagacttcatcgaacactctgacgtgccg
actgtgatggtgagcacctccgaccacgagacaggcggtctcgccgctgcccgtcaactg
cactctcccacttaccccgagtacctctggtacccctctgtgctcgcggccgccaaccac
tcagcatcctacacctcgcatgaattctccgctcaccactcagcggcacccaacgagaag
ccggaacaattcgcggcgttcgtcaaagatctcgtctcccgcgatctcggcatttccgac
ctctcctccgacgaggtcaagtccctccaagacaccccaaacctggcaccatacattttc
gccgacgtcctctcccgccgcgcacaaacaggttggtcgacacacggacactccggcgcg
gacgtgaacatttactcttcctcgcccgacgccgctgcggcgttgcaggggaatcatgag
aacactgaagtcggcgggttcttgcgggactacttgggcttgggcgaggaggtggagaag
gtcacgcggctgttgagggagcatgcgaaagggaaggcggaagaggaggtgtggttgggg
agtgtacccgaggagggcgagaggttggatggacagagtcatcgggaagatgggtatcat
ggggaacatcggacgagggcggagaagagagtgtgtgcagtttgtggagtttag

DBGET integrated database retrieval system