KEGG   Zymoseptoria tritici: MYCGRDRAFT_41093Help
Entry
MYCGRDRAFT_41093  CDS       T02285                                 

Gene name
MgAGL6
Definition
(RefSeq) putative alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00052  Galactose metabolism
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MYCGRDRAFT_41093 (MgAGL6)
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_41093 (MgAGL6)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MYCGRDRAFT_41093 (MgAGL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 13400674
NCBI-ProteinID: XP_003852859
JGI: Mycgr3_41093
UniProt: F9X8S9
LinkDB All DBs
Position
4
AA seq 967 aa AA seqDB search
MSSTASAQNTQFTVPASADEGVNILPTIQDPNAKQAQLLCPGYTASDVKHTVNGFTAMLN
LAGEACNVYGTDVETLSFELDVQTAHRMRISIQPAYIDNSNRSHYILDPDFVPLPQDGIP
ESDAQSIDLQFSWTNQPSFAFTVLRKSTGDVLFDTTGSVLVYENQYIEFVSQMPQDYNMY
GMGERIHDFRLGNNFTATFYAADVGDPIDQNIYGVHPFYLDTRYFEVNNQSGEHTMVAAE
NATSGGDYVGYSHGVFLRNAHGMEALMLPSNLTWRTLGGTIDLYIFDGPTPEAVTKQYQL
GAIGLPAMQQYWAFGFHQCRWGYHNWSETEAVVNAYRDFNIPLETIAKLEVVNFADPFPG
DFTNDQNTFPYEEGKEFLDRLHSRNQHYIPIVDSAIYIPNPDNASDAYSVYTDGNDRGVF
LSNPDASQYIGSVWPGYTVFPDWHANESVAWWTDSMKAHYANIPWDGIWIDMSEVSSFCV
GSCGTGNLSLNPVHPPFGLPGEEGSKIFSYPEGFNLTNATEAAVASSLSASQSSANAGPT
SASSTTMSYFTPPAVTPGVRNVNYPPYSINNVQGDLAVHAVSPNATHADGVEEYDVHNLF
GHQILNATYQALLEVFPNKRPMIIGRSTFAGSGKWAGHWGGDNTSLWAYMYFSISQALNF
ALFGIPMFGVDTCGFNGNSDEELCNRWMQLSAFFPFYRNHNTLSANSQEAYTWESVADAS
RKAMAIRYSLLPYMYTLFYNAHTTGSTVMRALSWEFPNDPSLAATDQQFLLGPALLITPV
LGQGQTSVQGVFPGVAQGEVWYDWYTQEAMSAQPGENVTIPAPLSHIPVFVRGGYVLPRQ
EALYTTAECRNSSWSLLAALDKNGAASGQLYVDDGESLVQNSTLLVDFTASNGTLYASSR
GLYEDKNSLANVTVLGVQSQPSAVTLNGQNVASGVAYNSTSKVLAVTGLRNLTSEGAWAS
DWTLTWN
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgagctccacggcatctgcccaaaacacccaattcactgtaccagcatcggcagacgaa
ggtgtaaacatccttccaaccattcaagacccaaacgcaaaacaggcccaactgctctgt
cccggctatacggctagcgatgtgaagcacaccgtgaacggtttcacggccatgctgaac
ttggctggcgaagcttgcaacgtctatgggactgacgtggaaacgctgtccttcgagttg
gatgtgcaaaccgcacaccgcatgcgtatttccattcagcctgcatatatcgacaacagt
aaccgcagtcattacatcttggacccggacttcgttcctttgccgcaggatgggatccca
gagagcgatgcccagagcatcgaccttcaattcagttggacaaatcagccttcctttgcc
ttcacagttttgagaaagtccactggagatgtcctctttgacaccactggcagcgttctg
gtgtacgaaaatcaatacatcgaatttgtctctcaaatgccgcaagactacaacatgtac
ggcatgggagagcgaatccacgatttcagacttggcaacaacttcacggccaccttctac
gctgctgatgttggtgatccgatcgaccagaatatctacggtgttcatcctttctacctc
gatacccgatacttcgaagtcaataatcagtccggagagcacacgatggtggctgcggag
aacgcaacctcaggtggcgactatgtcggctacagccacggtgtctttctacgcaacgcc
cacggaatggaagctttgatgttgccgtcgaacttgacctggaggactcttggaggaacc
atagatctctacattttcgacggcccaacgccggaagctgtcacgaagcagtatcaactt
ggcgctatcggtctccctgccatgcagcagtactgggcttttggcttccatcagtgtcgc
tggggataccacaactggtcggagacggaggcggtcgtcaatgcctaccgcgacttcaat
atccccctcgaaaccatcgcaaaacttgaagtcgtgaattttgctgaccccttcccaggg
gattttacgaatgatcaaaacacgttcccctacgaagaaggaaaggagtttctggatcgc
ctccattcaaggaatcagcactacatccccattgtagatagtgccatctatataccgaac
ccggacaatgccagcgatgcctactcggtttatacggacggcaacgatcgtggcgtcttc
cttagcaacccggacgccagccaatatattggctcagtgtggccgggctacactgttttc
ccagactggcacgccaacgagtctgtggcttggtggactgactccatgaaagcacactat
gcgaacattccttgggacggtatctggatcgatatgagcgaggtctcatccttctgtgtc
ggaagctgtggcaccggcaatctgtccctcaatccggtacacccacccttcggtctccct
ggcgaagagggtagcaaaatcttcagctatcccgaaggcttcaatctgacgaacgccacc
gaggccgctgtggcgtcttcgctttctgcatcgcagtcatccgccaatgctgggccaaca
tcggcatcctcaaccactatgtcctactttacgccaccggccgtcacgccaggtgtacgg
aacgttaactacccgccatattcgatcaacaacgttcagggagatctcgcagttcatgct
gtgagcccgaatgccactcatgcggatggtgtcgaggagtacgatgttcacaatctgttc
ggtcaccaaatcttgaacgctacctaccaggctctactggaagtgttcccgaataagcgg
cctatgatcattggccgtagcacctttgctggaagcggaaaatgggctgggcattggggc
ggtgacaatacttccctttgggcttacatgtacttcagcatctcgcaggcattgaacttt
gccctgttcggcattcccatgttcggcgttgatacttgcgggtttaacggtaactcggac
gaggagctgtgcaacagatggatgcagctcagcgctttcttccccttctaccgcaaccac
aacactctctctgcaaactcacaagaggcatacacctgggagtctgtcgccgatgcatcc
cgcaaggcaatggcgatccgatatagtcttctcccatacatgtacacccttttctacaac
gcccacaccactggcagcaccgtcatgcgtgcattgtcctgggagtttcccaacgatccg
agtcttgccgcgaccgaccagcaattcctcctcggacctgctcttctcatcactcctgtc
cttggacaaggccagacgagcgtccagggcgtatttccgggtgtcgctcaaggagaagtc
tggtacgattggtacacacaggaagccatgtccgctcagcctggcgagaacgtcaccatc
cccgctccactgagccacattccggtgttcgttcgcggtggctacgtcttgccacgccag
gaagcactctacaccaccgcagaatgcaggaacagttcttggagcctgcttgccgctctg
gacaagaacggcgccgcttccggccagctgtacgtcgatgatggcgagagcttggtgcag
aactcgacgctcttggtcgacttcacggcttcgaatggaacgttgtatgcttcctcacgc
ggtctgtatgaggacaagaactcgttggccaatgttactgttctgggggtacagtcgcag
ccgagtgcggtcacattgaatgggcagaatgttgcgtcgggagtggcatacaacagcacg
agcaaggttttggctgtgactggactgcggaatttgaccagtgagggtgcttgggcgagt
gattggactttgacgtggaattga

DBGET integrated database retrieval system