KEGG   Zymoseptoria tritici: MYCGRDRAFT_42503Help
Entry
MYCGRDRAFT_42503  CDS       T02285                                 

Gene name
MgSGA1
Definition
(RefSeq) putative glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_42503 (MgSGA1)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MYCGRDRAFT_42503 (MgSGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 13394161
NCBI-ProteinID: XP_003852428
JGI: Mycgr3_42503
UniProt: F9XB52
LinkDB All DBs
Position
5
AA seq 609 aa AA seqDB search
MRLLYSILPLAAAGLSEPPQHVLQPRATGSLSSWLSTQSSVARQGVLDNIGASGVKVEGA
SPGLVVASPSKSDPDYFFTWTRDAALVTKCLVDQFLSGGPASLEGGVQDYINAQASLQTV
QNPSGGLCSGGLGEPKFQVDGTAFTGNWGRPQRDGPALRATAMIAYARYLLGKGNTSAVT
NIIWPIVQNDLSYVSANWNQSGFDLWEEVNSASFFTTAVQYRSLVEGSALASKIGKSCSN
CDSQAPQILCFLQSYWTGSYIRSNTGGGRSGKDVNSILTSIHMFDPAVGCNANTFQPCSD
KALANHKVVTDSFRSVYSINNGIPQGQGVAVGRYPEDVYQGGNPWYLGTFAAAEQLYDAV
FQWKKQGTIEVTSISLPFFKDVYSSAAVGTYASSSAAFSSIVNAVSTYADSYMANAQKYT
PQNGALAEQYSRSDGTPLSAVDLTWSYAAFLTAANARRAAMPASWGANSAALPSSCSGSS
ATGPCATATSTFTRPTQSTPTCSATPTLTKVLFKEYATTTYGESISVVGSISQLGNWNTN
NAVALSAQNYTSSSNLWFVDISLPAGTSFQYKYIRKQSDGSVRWESDPNRSYTVPANCKG
QATVTDNWR
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttctatacagcatcctacctctcgctgcggccggactctctgaaccacctcag
catgtcctacaaccacgagcgaccggatcgctctcatcgtggctctccacacaaagctcc
gtggcccggcaaggcgtgctggacaacatcggagcgagcggcgtcaaggtcgagggagcc
agccctggtctcgtcgtagcttcgccctcgaaaagcgatccggactacttcttcacctgg
acgagagatgccgcactcgtcacgaaatgtctggtagaccagttcctttctggcggacct
gccagtctcgaagggggtgtccaagattacatcaacgcccaagcatctctccagactgtg
cagaatccatcgggaggtctctgctcgggtggtcttggtgagccaaagtttcaagtcgac
gggactgcattcactgggaactggggacgaccacagcgtgatggtcctgctcttcgtgct
actgccatgatcgcttacgctcgatacttgctcggaaaaggcaacaccagcgccgtgacc
aatatcatctggccaattgtgcagaatgatctgtcatatgtcagcgcaaactggaaccag
agcggctttgatctgtgggaggaggtcaacagcgcttctttcttcaccactgcagtgcaa
tatcgatcactggtcgagggcagtgctctagcttccaagatcggaaagtcctgctcaaat
tgcgactcgcaggctcctcagatcctctgtttcttgcagtcgtactggactgggtcctac
attcgatcaaacactggcggcgggcgatccggaaaggatgtcaactcaatcctcaccagt
atccacatgttcgatccggcagtgggatgcaacgcaaacacctttcaaccatgctccgac
aaagctttggcgaatcacaaagttgttactgactcattccgctctgtgtactctatcaac
aacggcatacctcaaggtcaaggcgttgcggtgggacggtatccagaggacgtttatcaa
ggaggcaatccatggtatttgggaactttcgccgctgcagaacaactctacgacgccgtg
tttcaatggaagaagcagggcacaatagaagtcacatcgatctcgcttccgttcttcaag
gatgtgtattcctcggctgcggttgggacgtatgcttcgtcctcggctgctttctcgtcg
attgtcaatgcagtctcgacatatgctgacagctacatggcgaatgctcaaaagtacaca
ccgcagaacggtgctctcgccgagcagtactcccgatcagatggcacacctctctctgca
gttgatcttacatggtcatatgcagcatttctgactgcggccaacgctcgtcgagctgcc
atgccagcttcatggggcgccaactcggctgcactcccatccagctgctcgggctcctct
gccacaggaccatgtgcaacggccacgagcaccttcaccagaccgacacaatcaactccg
acgtgcagtgcaacgccgactctgaccaaagtcctcttcaaggagtacgccaccacaaca
tatggtgagagcatttccgtcgtgggaagcatctcccagctcggcaactggaacaccaac
aatgccgttgctctgagcgcgcaaaactacaccagcagcagcaacctctggtttgtcgac
atcagtctgcccgctgggacctcgtttcaatacaaatatatccgcaagcagtcggatgga
agtgtgcgctgggagagcgatccaaatagaagctacactgtgccggcgaactgcaaggga
caggcaacagtcaccgataattggaggtga

DBGET integrated database retrieval system