KEGG   Zymoseptoria tritici: MYCGRDRAFT_53658Help
Entry
MYCGRDRAFT_53658  CDS       T02285                                 

Gene name
SDH1
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00020  Citrate cycle (TCA cycle)
ztr00190  Oxidative phosphorylation
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
ztr01200  Carbon metabolism
Module
ztr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ztr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ztr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCGRDRAFT_53658 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MYCGRDRAFT_53658 (SDH1)
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MYCGRDRAFT_53658 (SDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 13399113
NCBI-ProteinID: XP_003857174
JGI: Mycgr3_53658
UniProt: F9WWR1
LinkDB All DBs
Position
1
AA seq 643 aa AA seqDB search
MFSSTVRQFAGRSVVRPSRNFSSTARANKIITNSQPLRAKHASGSISAKYPIIDHEYDAL
VVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHDDDWRWHMYD
TVKGSDWLGDQDAIHYMTREAPASVYELENYGCPFSRTDDGKIYQRAFGGQSKEFGKGGQ
AYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEFFAIDLIMEDGECKGVIAYNQEDGTLH
RFRSHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGC
LITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPDKDHIY
LQLSHLPPEVLHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEVLTVD
ENGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNFSPNKPHKEV
SADAGAEAVSIVDQIRTADGAKSTAEIRSEMQKVMQSDVSVFRTQESLDEGVEKINKVDK
LFDQVGTKDRSMIWNSDLVETLELRNLLTCAVQTAEAAANRKESRGAHAREDFPDRDDEN
WMKHTLTWQRKPHTPVEIGYRSVVANTLDEAECKAVPPFKRTY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgttctcctccaccgtgagacagtttgcaggacgcagcgtcgtccgcccatcgcgcaac
ttctcctcgaccgcgcgagcgaacaaaatcatcaccaacagccagcctctgcgagcaaag
cacgcctcgggctccatctccgccaaataccccatcatcgaccacgaatacgatgccctg
gtagtcggcgctggtggcgctggtctgcgtgccgccttcggtctcgccgaggccgggttc
aacacagcatgtatatcgaagcttttcccgacacgatcacacaccgtggccgcgcagggt
ggaatcaacgcggcgcttggaaacatgcacgacgacgactggagatggcacatgtacgac
accgtcaagggatccgactggctcggtgaccaggacgccatccactacatgacccgcgag
gctccggcctccgtttacgagctcgagaactacggctgcccattctcccgtaccgacgat
ggcaagatttaccagcgtgccttcggtggacaatcgaaggagtttggaaagggaggtcag
gcataccgatgctgcgccgccgccgaccgaacaggccacgcgcttctgcacacactctat
ggccagtcgctccgacacaacaccaactacttcatcgagttctttgccattgatctcatc
atggaggatggtgagtgtaagggtgtaattgcatacaaccaggaagacggtactctccac
cgcttccgctctcaccacaccgttctcgctaccggcggatacggccgcgcctacttctct
tgcacttccgcccatacctgcaccggagacggaatggccatggtcgcccgtgctggtctt
cccaaccaggatctcgaattcgtgcagtttcacccaactggtatctacggagctggatgc
ttgattactgagggttctcgtggtgagggtggttaccttttgaacagcgagggtgagcgc
tttatggagcgttacgcacccactgctaaggatttggcatctcgcgatgtcgtgtcccgc
agcatgaccatggagattcgtgaaggccgcggtgtcggccctgacaaggaccacatctac
ctccagctttctcacttgccaccagaggtccttcacgagcgcctcccaggtatctctgag
accgcctcgatttttgccggtgtcgatgtcaccaagcagccaattcctgtgctcccaacc
gtgcactacaacatgggtggtatccccacgaagtataccggagaggttcttactgtggat
gagaacggcaaggacaaggtcgtgccaggccttttcgcttgcggtgaggctgcttgtgtg
tccgtccacggtgccaaccgtcttggcgccaactctctcctcgatcttattgttttcggc
cgtgctgtcagccacacgatccgcgacaacttctcgcctaacaagccacacaaggaggtc
tctgccgatgctggtgcagaggctgtgtctattgttgaccagatccgcactgcggatgga
gccaagagcacagccgagattcgcagcgagatgcagaaggtcatgcagtctgatgtctcc
gtgttcaggactcaagagtcgcttgacgagggtgttgagaagatcaacaaggtcgataaa
ttgttcgaccaggtcggcacaaaggaccgcagcatgatctggaattccgacctcgttgag
actctcgagctccgcaacctccttacctgcgccgtccagaccgccgaagctgccgccaac
cgcaaagagtcccgtggcgctcacgcacgcgaggactttcctgaccgtgacgacgagaac
tggatgaagcacacgctcacatggcagaggaagccgcacactccagtcgagatcggttac
cgctccgttgttgccaacacattagacgaggccgagtgcaaggctgttccacctttcaag
cgaacttattag

DBGET integrated database retrieval system