KEGG   Zymoseptoria tritici: MYCGRDRAFT_65440Help
Entry
MYCGRDRAFT_65440  CDS       T02285                                 

Gene name
MgAMY4
Definition
(RefSeq) putative alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_65440 (MgAMY4)
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MYCGRDRAFT_65440 (MgAMY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 13403158
NCBI-ProteinID: XP_003857587
JGI: Mycgr3_65440
UniProt: F9WZU9
LinkDB All DBs
Position
1
AA seq 518 aa AA seqDB search
MQVLNLIVLLLFTLCEAVLAANGPEWRSRTIYQVVTDRFALTNGSTTTACDTGLGLYCGG
TWAGITQRLDYIQDMGFDAVWISPVTKQLDGNSIDGTSYHGYWQTNINEVNSAFGSEDDL
RNLAAALHSRGMYLMVDIVVNHMAAHGPPEDVDYSVFTPFNDPSQYHSYCTIDYTDYTDD
ANIEQCWMGSTNVPLPDLRTEDSAVASQWNTWISNLVSDYSIDGLRIDSLMQVNRNFWGS
FMSAAGVYAVGEAYIIDNDFVCGFQDYVPGVMNYMIYQPLVDAFKSTSGSISGLVDAVTV
LKAGACKDTSLLGTFSENHDQPRFAALNGDMASAKNVIAFTMLTDGIPIIYQGQEQHYNA
LGGSSTPFNREALWLSGYNKDAELYKHVKTMNAIRKNAISDDSSYLSYQNNAVWSDSNNI
AMRKGSMLAVLTNSGSGAGNTTLSIPAGYEDGVQVTELLTCTTATSSDGNLSVPMSGGAP
RIYYPSVGIAGAGLCGASNTTLKSKLKLRNSRLFHLDY
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttctgaacctgattgtgttgctgctcttcacgctgtgtgaagccgtgctcgca
gccaacggcccggaatggcgcagcagaacgatctaccaggtcgtcacggatcgatttgcg
ctcaccaacggctccacgacgaccgcctgtgataccgggcttggcttgtactgcggtggc
acatgggccggtatcacgcagcgactcgattacattcaggacatgggcttcgatgcagtt
tggatctctccggtcacgaagcagctcgacgggaactcaatcgacggtacctcgtatcat
gggtattggcagaccaacattaacgaggtcaattccgcctttggttccgaggacgatctg
cggaacctggctgcagcactccactcccggggcatgtacttgatggtcgacattgttgtc
aaccacatggcggctcatggaccgccagaagatgttgattacagcgtgttcactcccttc
aacgaccccagccaataccacagctactgcacgatcgactacaccgattacacggatgat
gcgaacatcgagcagtgctggatgggaagcaccaacgtgccacttccggatctcagaacc
gaggactcagccgttgcttcgcaatggaatacatggatttcgaacctcgtctccgactac
tccatcgatgggctgcgtatcgactccctcatgcaggtcaacaggaatttctggggcagt
ttcatgtctgccgcaggtgtgtacgcggttggcgaagcgtacatcatcgacaatgacttc
gtctgtggtttccaagactacgtccctggtgtgatgaactacatgatataccaaccactc
gtcgatgcgttcaagagtacatcaggaagtatctcaggattggtcgatgccgtcactgtt
ctcaaggccggcgcatgcaaggatacctctcttcttggtaccttttccgagaaccatgat
caacctcgtttcgccgccctgaacggagacatggcttcggccaagaatgtcattgccttc
acgatgctgaccgatggcatcccgatcatctatcagggtcaagagcagcactacaacgcg
ttgggtggtagctctacgccattcaaccgtgaagcgttgtggctatccggctacaataaa
gacgcagagctgtacaagcacgtcaagacaatgaacgccatccgcaagaatgccatctct
gacgactcttcctacctctcctatcagaacaacgctgtatggagcgacagcaacaacatc
gccatgcgcaaaggaagcatgctcgccgttcttacgaattcgggatcaggagctggtaat
accacgctctccatacctgcgggctacgaagacggcgtgcaagttactgagctcctgacc
tgcactactgccacctccagcgacggcaatctgtcggttcccatgtctggcggcgctccg
aggatttactacccgtctgttggcatcgctggagcgggcctatgcggtgcgagcaatacg
acattaaagtcgaagctcaagctgcgcaactcgcgcctctttcacctcgattattag

DBGET integrated database retrieval system