KEGG   Zymoseptoria tritici: MYCGRDRAFT_68234Help
Entry
MYCGRDRAFT_68234  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00250  Alanine, aspartate and glutamate metabolism
ztr00410  beta-Alanine metabolism
ztr00430  Taurine and hypotaurine metabolism
ztr00650  Butanoate metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
Module
ztr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYCGRDRAFT_68234
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCGRDRAFT_68234
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCGRDRAFT_68234
   00430 Taurine and hypotaurine metabolism
    MYCGRDRAFT_68234
Enzymes [BR:ztr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MYCGRDRAFT_68234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 13403544
NCBI-ProteinID: XP_003855604
JGI: Mycgr3_68234
UniProt: F9X275
LinkDB All DBs
Position
2
AA seq 515 aa AA seqDB search
MVHLGKIATDKDVADRAPAAIDESKLGAPGQDEFTGSVYGSRFAAADLPKHEMPEDEMPR
EVAYRMIKDDLTLDGTPTLNLASFVTTYMEDEAEKLMIDAFSKNFIDYEEYPVSADIQNR
CVSMIARLFNIPSHDENTNAMGTSTVGSSEAIMLATLAMKKRWTNKRKAEGKDFSRPNIV
MNSAVQVCWEKAARYFDVEEKYVYCTPDRYVIDPEEAVNLIDENTIGICSILGTTYTGEY
EDTKAINDLLVERNIDCPIHVDAASGGFVAPFVNPNLVWDFRLEKVVSINVSGHKYGLVY
PGVGWVVWRDPEFLPKELIFNVNYLGADQASFTLNFSRGASQVIGQYYQLIRLGKKGYRS
IMFNLTRNADYLAASVQQMGFLLMSKTRGEGLPLVAFRLDPAQNHKFDEFAVAHRLRERG
WVVPAYTMAPHSEKLKMMRVVVREDFSRSRCDALVADLQMALNELKKMDEKALEQDKEHR
RARAQRAVQKIRTNGHFSNEDHSLKGKHGKTHAPC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggttcacctgggcaaaattgccaccgacaaggacgtcgccgaccgagcacccgctgcc
atcgacgagtcgaagctaggagctcccggtcaagatgaattcaccggcagtgtttacggc
tctaggtttgcggctgcagatttgcccaagcacgagatgccagaggatgagatgcctcgg
gaagtcgcctatcgtatgatcaaagacgacttgacgctcgatggcactccgacgttgaac
ctcgcatcattcgtcaccacctacatggaagatgaagccgaaaagctcatgatcgatgcc
ttttccaaaaacttcatcgattacgaagagtaccccgtttcagccgacatccagaaccgc
tgcgtctctatgatcgcccgcctctttaacatcccatcgcacgacgaaaacaccaatgcc
atgggaacatcgaccgtcggctcctccgaagccatcatgctcgccactctcgccatgaag
aagcgttggacgaacaagcgaaaggccgagggcaaggacttcagccggcccaatatcgtc
atgaactcggcggttcaggtctgctgggaaaaggcggcgagatactttgatgtcgaggag
aagtatgtttactgcacacccgaccgctacgtgatcgatccggaagaggcggtcaatttg
attgatgagaacacgattggtatctgctccatcctcggtacaacttacacgggagagtac
gaggacaccaaagcaatcaacgatcttctcgtggagaggaacattgactgcccgattcac
gtcgatgctgcgtctggtggtttcgttgcaccctttgtcaaccccaacctcgtgtgggat
ttccgtctggagaaggtggtttcgatcaatgtgtctggccacaagtacggtcttgtgtat
ccaggtgtcggctgggtcgtttggcgtgatccggagtttctgccaaaggagctcatcttc
aacgtcaactaccttggcgcggatcaagcatccttcacgctgaacttctctcgtggcgct
agtcaggtcattggacaatactaccagctcatccgcctgggaaagaagggctatcgtagc
atcatgttcaacctcacccgcaacgccgactatctcgccgcgtcggtccagcagatggga
ttcctcctcatgtccaagacccgcggcgaaggtctcccactcgttgccttccgcctcgac
cctgcgcagaaccacaaattcgacgagttcgccgtcgctcaccgtttgcgtgaacgcggc
tgggtcgtgccggcttacaccatggctccacactcggagaagctcaagatgatgcgtgtg
gtggtgcgcgaggatttctcgcgcagccgatgcgatgctctcgtggcggatctgcagatg
gcgttgaacgagctgaagaagatggacgagaaggcgttggagcaggacaaggagcaccgc
cgggcgcgcgcacagagagccgtgcagaagatcagaaccaacggacacttttcgaatgag
gatcacagcttgaagggcaagcacgggaagacccacgcgccttgttag

DBGET integrated database retrieval system