KEGG   Zymoseptoria tritici: MYCGRDRAFT_68344Help
Entry
MYCGRDRAFT_68344  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MYCGRDRAFT_68344
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ztr03400]
    MYCGRDRAFT_68344
Enzymes [BR:ztr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MYCGRDRAFT_68344
DNA repair and recombination proteins [BR:ztr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     MYCGRDRAFT_68344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C BRCT LIG3_BRCT DNA_ligase_IV mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 13399568
NCBI-ProteinID: XP_003855560
JGI: Mycgr3_68344
UniProt: F9X2V5
LinkDB All DBs
Position
2
AA seq 964 aa AA seqDB search
MYGHGSMTQDEMDEKYPGRPKNHAKTLPFHELYTTLFNPLNENKKKPTGPSIARKKEGPH
GQGQAPHEARRSIIDRFISRWRKQVGNDIFPAIRLIVPEKDRERGMYGIKEMTLGKLLVR
VMKINKDSEDGYNLLHWKLPGVKASSAMAGDFAGRCFEVISKRPMRQTPGDMTIAQVNEM
LDRLSVAQKEENQRPIIEEFYNRMCAEEMMWLIRMILRQMKVGASERTFFDVWHQDAENL
FNISSNLRRVCWELWDPDVRLEGDSAGIALMQCFQPQLAAFQMRSMEQMVARMKPTEEDA
EFWIEEKLDGERMQLHMVEDDQIPGGKRFGFWSRKAKDYTYLYGKHFEDDNSALTRHIKN
AFNEGVRNIILDGEMITWDPKEQALVPFGTLKTAALSEQQNPFSTGNRPVFRIFDCLFLN
DKDLTHYTLRVRHEALLKSVTSIDQRMEIHEHQKATQASEIEPVLRKVVAEASEGLVLKN
PRSEYRLNERNDDWIKVKPEYMTEFGESLDCIVVGGYYGSGKRGGGLSSFLCGLKPQQAI
FSSQNRNINPQMVLSFFKVGGGFAASDYAEIRHRTEGKWTDWNAKKPPTDWVVLGGGDRQ
FEKPDVWIKPEDSIVLSVKAASVTGTTQFATGCTLRFPRFKKLRTDKDWTQALTQDEFNA
LRKRVEAEVEEKKMKIDDTRKQKVGPKRKKRELVIQGQEDAVRAPYAGPATKVFEGLSFF
VMTEAPKPLKKTKAELEQLIKANGGNVVASEKDPDTIIIADRNMVKVASISKHDKRSIIR
PSWLLDCVRQSEIDIGRPALLLPLEKFHLFHTASAEQGRFDDNVDEYGDSYARDITTEEL
LALCNAMPSKMEDGLNPDEVLEQFHDHGHELDAMKGFMFRGTTAYFDDVPAEAIRLFKFA
GGQIADSIEDDQLTHVVLHTGCSPAATRKAVSSKQQLPRIVTESWVADSWSEATRLDEEQ
FVPS
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgtacggccacggatcgatgacacaagatgaaatggatgaaaagtatcctggtcgtcca
aagaaccatgcaaagacgttgccattccacgaactttacaccactctgttcaaccctctc
aatgagaacaagaagaagccaacgggtccatcaatcgcgcgcaagaaggaaggccctcac
ggtcaaggccaagcaccgcatgaagcgcgacgctcgatcatcgatcgcttcatctcgaga
tggcgcaaacaggtcggcaacgacatctttcccgcaatacgcctcatcgtccctgagaag
gatcgtgagcggggtatgtacggcatcaaggagatgactctcggtaagctgctcgtccgt
gtgatgaagatcaacaaagatagcgaagacggttacaatctcttacactggaagctgcct
ggagtcaaagcatcaagtgcgatggctggcgacttcgctggacgatgcttcgaggtcatc
agcaagcgacccatgcgccagactcctggtgatatgacaatcgcgcaggtgaacgaaatg
ctggatcgactgtctgtagcgcagaaggaggagaatcaacgacccatcatcgaagagttc
tacaatcgaatgtgcgccgaggaaatgatgtggttgattcgtatgatcttgcgtcagatg
aaggtcggtgcttccgagaggacatttttcgacgtttggcatcaggacgcagagaatctt
ttcaacatctctagcaatctccggcgagtctgctgggaattgtgggatccagacgttcgc
cttgagggcgacagcgctggaattgcgcttatgcaatgttttcagccacagcttgcagct
ttccagatgcggtcaatggagcaaatggtggctcggatgaagccgactgaagaagatgca
gagttctggatcgaggagaagttggacggcgaacgaatgcaactgcatatggttgaagac
gatcaaataccgggcggcaaacgattcggcttttggtcacgcaaagcaaaggactatacc
tacctgtatgggaagcacttcgaagacgacaactccgccctgacacgccacatcaagaac
gctttcaacgagggcgtgcggaacatcattctagatggagagatgatcacctgggacccg
aaggagcaggctttagtgccctttggtacgctcaaaaccgctgctctttcggaacaacag
aatccatttagtaccgggaatcgacctgtgttccggatattcgactgcctattcctcaat
gacaaggacctgactcactacaccttgcgcgtccgacacgaagcacttctgaagagcgtc
acatcgatcgatcaacgaatggagattcacgaacatcaaaaagcgactcaagcgtcagaa
atcgagcccgtgctgcgaaaagtcgtggctgaggccagcgaaggcttggtcttgaagaat
cctcgctcggagtaccgcttaaatgagcgaaacgatgactggattaaggtgaagcccgag
tacatgacagagttcggcgaatcgctggactgtatcgtggtaggaggctactatggttcc
ggcaagagaggtggaggcctgagcagtttcctgtgtggtctgaagccgcaacaagcaatc
ttcagcagtcagaatcgtaacatcaaccctcagatggtgctctcgttcttcaaagttggt
ggaggatttgccgcatctgattatgctgagatccgccaccgaaccgagggcaagtggacg
gactggaatgccaaaaagcctcccacggactgggtcgtccttggtggaggtgaccgccag
ttcgagaaacccgacgtgtggatcaagcctgaggattcaatagtgctatcggtcaaagcc
gcatctgtgaccggcacgacgcaattcgccactggctgtacattgcgcttcccgcggttc
aagaaactaaggaccgacaaggactggactcaagccttgacacaggacgagttcaacgct
ctgcgaaagagagtggaagccgaggtggaggagaagaagatgaagattgacgatactcgg
aagcagaaagtcggaccaaaacgcaagaagagggagttggtaatacaaggacaagaggat
gcggtcagggcgccgtatgcgggtcctgccacaaaggtcttcgaggggttgtcgttcttc
gtcatgactgaagcaccgaaaccgttgaagaaaaccaaggccgaactcgaacaactaatc
aaggccaatggcggaaacgtcgtcgcttcagagaaagatccagacacaatcatcattgcg
gaccgaaacatggtcaaggtcgcgtcaatctccaagcacgacaaacgcagcatcatcaga
ccgtcctggcttttggactgtgtccgacaaagcgagattgacatcggtcgacctgcgctg
ctactgcccctggagaaattccacctcttccacaccgcgtctgccgaacaaggcagattt
gacgacaacgttgacgaatatggcgacagctatgcccgtgatatcacgactgaagagctg
ctggcattgtgtaatgctatgccgtccaaaatggaggatggtctgaaccctgacgaggtg
cttgaacagttccacgaccatggtcatgagctcgatgctatgaaaggtttcatgtttcgc
ggtaccactgcctacttcgacgacgtacccgctgaggcgatacgcctgttcaaatttgct
ggtggacaaatagccgactcgatcgaagacgatcaattgacgcatgtcgtcttgcacaca
ggctgttctccggccgccacgaggaaagcggtttcttcgaagcagcagcttccccgaatt
gtgaccgagagctgggtcgcggacagctggagcgaagcaacaagactcgacgaggagcag
tttgtaccttcgtga

DBGET integrated database retrieval system