KEGG   Zymoseptoria tritici: MYCGRDRAFT_70646Help
Entry
MYCGRDRAFT_70646  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00250  Alanine, aspartate and glutamate metabolism
ztr00410  beta-Alanine metabolism
ztr00430  Taurine and hypotaurine metabolism
ztr00650  Butanoate metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
Module
ztr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MYCGRDRAFT_70646
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCGRDRAFT_70646
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCGRDRAFT_70646
   00430 Taurine and hypotaurine metabolism
    MYCGRDRAFT_70646
Enzymes [BR:ztr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MYCGRDRAFT_70646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 13400852
NCBI-ProteinID: XP_003853580
JGI: Mycgr3_70646
UniProt: F9X855
LinkDB All DBs
Position
4
AA seq 548 aa AA seqDB search
MALASHVDPDELMAQLHKSPHHQHGRGSSAVSHITPYSSRYNAQSELSKFKIPHDGAPAD
AVHQMLKDELDLDGRPNLNLASFVGTYMEREAEQLMVENLSKNMSDADEYPAMMQMHARC
VSIIAHMWNVQKGEKAIGSATTGSSEAIHLGGLAMKRRWQEKRQAAGKDTSKPNIIMGAN
AQVALEKFARYFEVEARILPVSAKSNYRLDPELVKQNIDENTIGIFVILGSTYTGHYEPV
EEISNILDAYEKETGVDIPIHVDAASGGFIAPFTNAKAGGPKWDFALPRVKSINVSGHKF
GLVYAGVGWIIWRDESYLPKHLVFELHYLGGTEESYTLNFSRPGAQIIAQYFNLIHLGFT
GYRAIMENALSNARLLSKSLESTGWYKCVSDIHRPKGQHEYQKGVIAPTKEGETSADYNA
GLPVVAFALTDEFKQKYPHVKQVSVSNLLRAKQYIIPNYPLPPNEEKLEILRVVVRESMS
LDLLDRLITDICEVTENIMNTDAVDMQVYQPASSNTTTEKKHSSRGLGAHEKHAAKRPMS
EGVHRTVC
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgcatcacacgtagacccggatgagctcatggctcagctccacaagagtcct
caccaccagcacggccgcggatcaagcgcggtctcgcacatcacaccatacagctcgcga
tacaatgctcaatccgagctgtcaaagttcaaaattccgcacgatggagctcccgccgac
gctgtgcatcagatgctgaaagacgagttggatctcgacggcaggcccaaccttaacttg
gcctctttcgtgggaacatacatggagagggaggccgagcagctcatggttgagaatctg
tcaaagaacatgagtgacgccgatgagtacccagcaatgatgcaaatgcatgctcgttgc
gtctcaatcattgcacacatgtggaacgtccaaaaaggtgagaaagccattggctcagcc
acgaccggttcctccgaagccattcacttgggaggcctagccatgaagcgacgctggcaa
gagaagcgccaggcggcaggcaaggacacctcgaaacccaacatcatcatgggagccaac
gctcaggttgctctggagaagttcgcccgctacttcgaagtagaagctcgcatcctccca
gtcagcgccaaatccaactaccgcctcgacccagagctcgtcaagcaaaacatcgacgag
aacacgattggaatctttgtcatcttgggaagcacctacaccggacactacgagcctgtg
gaggagatctcgaacatcttggatgcgtatgagaaagagactggagtggacatcccaatt
cacgtcgatgctgcttcaggcggattcatcgctcctttcacaaacgccaaagcaggcggt
ccgaagtgggactttgctctgccgcgagtgaagtcgatcaacgtcagtggacacaagttt
ggactggtgtacgctggagtgggttggatcatttggagggatgagtcgtacctgcccaag
catctcgtcttcgagctgcactacctaggtggtactgaggagtcgtacacgctcaacttc
tcgcgtccgggagcacagatcattgcgcagtacttcaaccttatccacttgggcttcacc
ggctaccgcgccatcatggagaatgcattgagcaatgcccgcctgctctccaaatctctc
gagtcgaccggctggtacaagtgcgtgagcgacatccaccgtcccaagggccagcacgag
taccaaaagggcgtcatcgcaccgaccaaggaaggcgagacctcggccgactacaacgcc
ggtctgcccgtcgtggccttcgccttgacggacgagttcaagcagaaatacccgcacgtc
aagcaagtgagcgtcagcaacttgctgcgagcgaaacaatacatcattcccaactacccc
ctcccacccaacgaagaaaagctcgaaatcctccgcgtcgtcgtccgcgaatccatgtcc
ctcgacctgctcgaccgcttgatcacggatatctgcgaggtgacggagaatatcatgaac
acggacgcggtggatatgcaggtgtaccagccggcgagcagcaacacgacgacggagaag
aagcacagcagtcggggactgggcgcgcatgagaagcacgcggcgaagaggccgatgagt
gagggtgtgcatcggacggtttgttag

DBGET integrated database retrieval system