KEGG   Zymoseptoria tritici: MYCGRDRAFT_71498Help
Entry
MYCGRDRAFT_71498  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00020  Citrate cycle (TCA cycle)
ztr00190  Oxidative phosphorylation
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
ztr01200  Carbon metabolism
Module
ztr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ztr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ztr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCGRDRAFT_71498
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MYCGRDRAFT_71498
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MYCGRDRAFT_71498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 13399944
NCBI-ProteinID: XP_003853276
JGI: Mycgr3_71498
UniProt: F9XAC6
LinkDB All DBs
Position
4
AA seq 662 aa AA seqDB search
MAQRVFLDCLRSSTFTTSSLLHRSSPAIRRPRRTPPTIPQRRTHLTLPQRRRATTASGSA
ISSSTNHPIIDHHYDAIVLGAGGAGLRAAVGLAESGLETACITKLFPTRSHTVAAQGGIN
AALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKAVYELENYGMAFSRTEDGRI
YQRALGGQSLKYGKGGQGVRCCSAADRTGHAMLHTLYGQSVKHNTNFFIEYFAIDLLMVD
GACVGVLCMSMEDGTLHRVFAKNTVMATGGYGRTYFSCTSAHTSTGDGNAMAARAGLPNQ
DFEFIQFHPTGIYGAGVLITEGSRGEGGYLLNASGERFMERYAPTAKDLASRDVVSRSMN
MEIREGRGCGPDKDHVYLQLSHLPKELIYERLPGIAETASVFSGVDVTKDPIPVLPTVHY
CMGGVPTNWKGEVLNVDPITGAEKPVEGLYAAGEVACVSVHGANRLGANSLLDIVVFGRA
CALDIASKNEKGMPHKKAPEDIGMNSVRDMESIRTADGDKLSAEIRSDMQKVMQADISVF
RTQEALEQGVARLENVQKDFNTRLSVKDRSMIWNSDLIETMEMRNLLTCAAQTAKSALLR
KESRGSHAREDFPDRDDKGWMKHTLSWQGDVGEEVKIGYRGVVMDTLDKSEMESIPPVKR
TY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcccaacgagtattcctagactgcttgcgctcctccacgttcaccacctcctccctc
ctccaccgctcgagcccagcaatacgacgaccacgacgaacacctccaaccatccctcaa
cgtcgcacccacctcacactccctcaacgccgccgcgccaccacagcctccggctccgcc
atctcctcctccacaaaccaccccataatcgaccaccactacgacgccatcgtcctcggc
gccggtggagccggtctccgcgccgccgtcggactcgccgaatccggcctcgaaacagcc
tgcatcaccaaactcttccccacacgctcgcacactgtcgccgcacaaggcggcatcaac
gccgcgttgggcaacatgacggaagatgactggaggtggcatatgtacgacacggtgaaa
ggaagtgactggttgggggatcaggacgcgattcattatatgtgcagggaggcgccaaag
gcggtgtatgagttggagaattatggcatggcgtttagtcggacggaagatggaaggatt
tatcagagagcgttgggagggcagagtttgaagtatgggaagggaggacaaggggttagg
tgttgtagtgcggcggatcggacggggcatgcgatgttgcatacgctttatgggcagagt
gttaagcacaacacgaatttcttcatcgagtattttgcgattgatctgctgatggtggat
ggagcgtgtgtgggtgtgctgtgcatgtccatggaagacggcacgcttcatcgtgtgttc
gcgaagaacacggtcatggcgacgggtggctacggacggacgtatttctcctgcacttct
gcgcatacctcgactggagatgggaacgccatggccgcccgtgccggacttcctaaccaa
gacttcgaattcatccaatttcacccaacaggaatctacggcgccggcgtgctcatcact
gaaggctcccgcggtgagggaggatatctgctcaacgcttccggcgaacgcttcatggag
cgctacgctccgacagcgaaggacctcgcttcccgagacgtagtctctcgatcgatgaac
atggaaatccgagaaggacgaggctgcggacctgacaaagaccacgtctacctgcaacta
tcccatcttccgaaggaactaatctacgaacgactccccggcatcgcagagacagcgagc
gtcttctccggcgtagacgtcacgaaagaccccatccccgtcttaccaacagtccactac
tgcatgggcggcgtccccacaaactggaaaggcgaagtcctcaacgtcgaccccatcacc
ggcgccgagaagcccgttgaaggactctacgccgccggcgaagtcgcgtgcgtcagtgtc
cacggcgcgaaccgtctcggtgcgaattctctgcttgacatcgttgtctttggccgagct
tgcgccctcgatattgcgtcgaagaacgaaaagggtatgccgcataagaaagctcctgag
gacatcgggatgaactccgtgcgggatatggagagtatccgcaccgcagacggagataaa
ttatcagcggaaatccgctcggacatgcaaaaagtcatgcaagcagacatctccgtcttc
cgcacgcaagaagcattagagcaaggcgtcgctcgactggaaaatgtgcaaaaagacttt
aacacgcggctcagcgtcaaagatcggagtatgatctggaatagcgacctgatcgaaaca
atggagatgcggaatctcctgacgtgtgcggcgcagacggccaagtcggcactgttgagg
aaggagagtaggggtagtcatgcgagggaggattttccggatagagatgataagggctgg
atgaagcatacgttgagttggcagggggatgtgggagaggaggtgaagattgggtatcgc
ggggtggtgatggatacactggataagagcgagatggagagtattccgccggtgaagagg
acttattag

DBGET integrated database retrieval system