KEGG   Zymoseptoria tritici: MYCGRDRAFT_74660Help
Entry
MYCGRDRAFT_74660  CDS       T02285                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00500  Starch and sucrose metabolism
ztr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_74660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ztr01003]
    MYCGRDRAFT_74660
Enzymes [BR:ztr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MYCGRDRAFT_74660
Glycosyltransferases [BR:ztr01003]
 Polysaccharide
  Storage polysaccharide
   MYCGRDRAFT_74660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 13402800
NCBI-ProteinID: XP_003850006
JGI: Mycgr3_74660
UniProt: F9XHH4
LinkDB All DBs
Position
8
AA seq 722 aa AA seqDB search
MGEPQHRDVRNHVLFEIATEVANRVGGIYSVLKSKAQVTTAEYGSMYTLLGPLNRASAAV
EVEEIEPRDPAMINTIKSMNDRGIKTLYGRWLIDGAPRVLLFDTSTGYYKLDEWKGDLWS
TAGIPSPPDDHETNEAIVFGYLIAWFLGEYVYHEKERAVIAQFHEWLAGVALPLCKKRKI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERGAAHSADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQVNKERITEFIRGHFYGHN
DFDPDKTLYLFTAGRYEYRNKGVDMFIESLARLNHRMKSAGSDMTVVAFIIMPAQTTSLA
VEALKGQAVIKSLRDSVDHIEKSVGKKLFEKALAWHEGAEVPDEKDLITAQDKIMLRRRL
FAMKRNTLPPIVTHNLVNDAEDPILNQIRRCQLFNHPSDRVKVIFHPEFLSSGNPVLPMD
YDDFVRGTHMGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENAQDYGIYI
VDRRMKGVDDSVNQLAEFMYQFTQKSKRQRINQRNRTERLSDLLDWKRMGMEYVKARQLA
LRRAYPDSFDSATDDEPGFFDGTESMKISRPLSAPGSPRERSGMMTPGDFASLQEGREGL
STEDYIAWKLPEEEEPEDYPFPLTLKTKKGDGSGATTPTMTNGNGNVALPDRGVLASAST
IQ
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaccacagcaccgcgacgtgcgcaaccatgtgctcttcgaaatcgctaccgag
gtcgccaaccgtgtcggaggtatctacagcgtgctgaagtcgaaagcacaagtcaccacc
gcagaatatggctccatgtacaccctgctcggtcctctcaaccgcgcttcggccgccgtc
gaggtcgaagaaatcgagccaagagatcccgccatgatcaacaccatcaagagcatgaat
gacaggggaatcaagacactgtacggaagatggctgattgatggtgctcctcgtgtgttg
ctcttcgacaccagcacgggttactacaagctggacgagtggaagggcgatctttggtcg
acggctggcattcccagcccgccagatgatcacgagacgaacgaggccattgtgtttgga
tatctcattgcgtggttcttgggcgagtacgtctaccacgagaaggaaagggctgtcatt
gcacagttccacgagtggctggccggtgttgctctccccttgtgtaagaagcgcaagatt
gatgtgactaccatcttcaccacccacgctacccttctcggacgctacctctgcgccggc
tccgtcgatttctacaacaacctgcagtactttgacgtggacgccgaggctggaaagcgt
ggtatctaccaccgatactgcatcgagcgtggtgccgctcacagcgctgatgtgttcacc
accgtcagccatatcacggcatacgagagtgagcacctgctcaagcggaaacctgatggc
gtccttcccaacggtctgaacgtgaagaagttctccgctacccacgagttccaaaacttg
caccaggtcaacaaggagcgcattactgagttcattcgaggacacttttacggtcacaat
gatttcgatcccgacaagacgctgtacctcttcaccgctggtcgctacgaataccggaat
aagggcgtggacatgttcatcgagtcgctggctcggttgaatcaccgaatgaagagcgcg
gggtcggatatgacagtcgttgcattcatcatcatgcccgcgcaaaccacatctcttgct
gttgaggcattgaagggacaggctgtgatcaaatctctgcgcgattccgttgatcacatc
gagaagagtgtgggcaagaagcttttcgagaaggctcttgcatggcacgagggtgctgag
gtgcctgacgagaaggacctcatcacggctcaggacaagatcatgctgaggagacgcctc
ttcgccatgaagcgcaacactcttccaccgatcgtcacgcacaatttggtcaacgatgcc
gaggacccgattctcaaccagatccgtcgctgccagcttttcaaccacccatccgatcgt
gtcaaggttattttccaccccgagttcttgtcctccggcaacccggtcctcccaatggac
tacgacgatttcgtccgcggtacgcatatgggtgttttcagctcatactacgagccgtgg
ggctacactcccgccgagtgtaccgtcatgggtgttccgtccatcaccaccaacttgtcc
ggatttggatgctacatggaggaactgatcgaaaatgctcaagactacggcatctacatc
gtcgaccgcaggatgaagggtgtcgatgactccgtcaatcaactcgcggagttcatgtac
caattcacacaaaagagcaagcgtcaacgcatcaaccagcgtaatcgcacggagcgattg
agcgatctgctcgactggaagaggatgggcatggaatacgtgaaggcgagacaattggct
ttgaggagagcgtacccggatagcttcgacagcgcgacggatgacgagcccggtttcttc
gacggcaccgagagcatgaagatttcgaggcctttgtctgcgcctggtagcccgagggag
agaagcggcatgatgactcctggtgactttgcttcgctgcaagaagggcgggaaggattg
agcacggaggattacattgcgtggaagttgcccgaggaggaagagccggaagactacccc
ttcccactcacgctcaagacgaaaaagggcgacggatccggcgccacgacacccaccatg
actaacgggaatggcaatgttgcgttgccggatcggggcgtgttggcgagtgcgagtacg
attcagtag

DBGET integrated database retrieval system